Reads as set of mzId files containing PSMs an generates a data.frame.

readMzIdData(files)

Arguments

files

A character of mzid files.

Value

A data.frame containing the PSMs stored in the mzId files.

Details

This function uses the functionality provided by the mzR package to access data in the mzId files. An object of class mzRident can also be coerced to a data.frame using as(, "data.frame").

See also

filterIdentificationDataFrame() to filter out unreliable PSMs.

Author

Laurent Gatto

Examples

idf <- "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid"
f <- msdata::ident(full.names = TRUE, pattern = idf)
basename(f)
#> [1] "TMT_Erwinia_1uLSike_Top10HCD_isol2_45stepped_60min_01-20141210.mzid"
readMzIdData(f)
#>                                      sequence
#> 1                                RQCRTDFLNYLR
#> 2                      ESVALADQVTCVDWRNRKATKK
#> 3                                KELLCLAMQIIR
#> 4                      QRMARTSDKQQSIRFLERLCGR
#> 5                    KDEGSTEPLKVVRDMTDAICMLLR
#> 6                   DGGPAIYGHERVGRNAKKFKCLKFR
#> 7                      QRMARTSDKQQSIRFLERLCGR
#> 8           CIDRARHVEVQIFGDGKGRVVALGERDCSLQRR
#> 9           CIDRARHVEVQIFGDGKGRVVALGERDCSLQRR
#> 10                       VGRCRPIINYLASPGGTSER
#> 11                     WLYWSAVTRYPQCQLSLAQLDR
#> 12                              RLLCVTRWVLALR
#> 13                                  RRCLVQVTR
#> 14             LDRDASSHVAVTKIGLEKCARLIRLAIEGR
#> 15                SKEDLLDIKNLVILPEVELTECAVLYR
#> 16                        QRLDEHCVGVGQNALLLGR
#> 17           VDYQGKKVVIIGLGLTGLSCVDFFLARGVVPR
#> 18                          CREGLLGVLESLQPGTR
#> 19                                   TLIIERCR
#> 20                       QEVESCTTIEKIWVIDLKIK
#> 21             MANSIFMKITGKIQGLISEGCLSIDSVGNK
#> 22                   CANLTHPDIHFQPSLLSVPEVLLR
#> 23                           KCNQCLKVACTLFYCK
#> 24                           KCNQCLKVACTLFYCK
#> 25                           KCNQCLKVACTLFYCK
#> 26                           KCNQCLKVACTLFYCK
#> 27                      YAITLSLLCANPEINRGTLEK
#> 28                            IVLDPRRARLQCQRR
#> 29                                    RCIEIKR
#> 30                            SFCSELRQDMLVACR
#> 31                            SFCSELRQDMLVACR
#> 32                             CYLETTGHLTSAIR
#> 33                                  NDCIVIVGR
#> 34                       RWLARGFGVSFREVKVGCRR
#> 35                             PYDAIYQACLLRFR
#> 36                         RGEDGIVLIDQDKCRGWR
#> 37            PILPNQLAEGVDLYAPCPPVSWEMLGLNTLR
#> 38                   RHKAHPASDTGLFLRDCGSAVAER
#> 39                           RIGSNLCNSLAFDIIR
#> 40       LDPLVGSPYAAALHPFASIDFSQGNCKLWGAPATAR
#> 41                             PTCARLLPARQCLR
#> 42                             PTCARLLPARQCLR
#> 43                                   RVFCLTLR
#> 44                     VLFIYALAGLVTVCGCIILALR
#> 45                     VLFIYALAGLVTVCGCIILALR
#> 46                                 RQMNEVCVQR
#> 47                                  LCLKITTVR
#> 48                                  RCIEIKRAR
#> 49     FRRMFSYYLNACAGTFRARELQLWQIVFSINGIDGGLR
#> 50                      YHCSLLGQLPLHISLREDLDR
#> 51                                   RSILCAER
#> 52                         YLVACETLEVEPLIVLNK
#> 53                                RFTIECSGVRR
#> 54                                 RQMNEVCVQR
#> 55           DAFAQFGGDKAVFDTQCNVELIVAYNGDIKTK
#> 56                  TAQILEFDLWQHSEGQTVWVLMYCR
#> 57                            EWGHPIKKDPQVCAR
#> 58                        QADISCTVTPLGDDRITVR
#> 59                        KQSVPLQEPYHITPCSARR
#> 60                    GLWIVAIVSSCFSMVILVLLVLR
#> 61                             QPWLYGRNKVSCPR
#> 62                 SSHTVLIIENIGAAICENVVYQILPK
#> 63                                 RTAEICEKLK
#> 64                       CLYIAVKDSVTLEVNRLSLR
#> 65                          MEVVRADARWGAVASCR
#> 66                              WRSQRQILRVLCK
#> 67                 GAKDIHVFAPDSMPWVQYGFLAVKCR
#> 68                       CPTELLPYLAWALSVDRWDK
#> 69                      GAGIKVCSGGIVGLGETVRDR
#> 70               LLERCRSDLQWDRAVQQLFNDALTSVRK
#> 71                            NDIIDQAFESCKRLK
#> 72             RADPMIFGLPNNCSPVLLVAKVPWQDLALR
#> 73         KINIRTPRAAGKLGFGYCPEDRKTDGIVGAATVR
#> 74            GGFPAQSGRYHLYVSLACPWAHRTLLMRQLK
#> 75                        EELIVLRDLLQSGHVSCGK
#> 76                               LPAVLLLCQCLR
#> 77                               LPAVLLLCQCLR
#> 78                 YTTTFYVAALTERVSVGYMRCLGIVR
#> 79                   KIETNFLTTLFADSREGCGILAVR
#> 80                                VYGVSFCGAPR
#> 81                                ACIDLVKQKVR
#> 82                             RRRACCAAITTKDR
#> 83                             RRRACCAAITTKDR
#> 84                                 RTSVIRQDCR
#> 85                                   RCKKERIR
#> 86                      GAGIKVCSGGIVGLGETVRDR
#> 87                 EVIIQRCSVLHVTWMPAHEITFDCLR
#> 88                 EVIIQRCSVLHVTWMPAHEITFDCLR
#> 89                         QKTRCATRAFKANKGRAR
#> 90                         QKTRCATRAFKANKGRAR
#> 91                            EVIKCFLKLWRIELK
#> 92                       KIREEEKEEPDRYACAKLKR
#> 93                      RLCDEDLQDKHQELFAVLAER
#> 94                 VEAVVRNDAHKLIEECMILANISAAK
#> 95                                   IDLSICLR
#> 96           QLLQKKCTLLEQWAAAQGAEVSFFLMDESRFR
#> 97                      MRIHILGICGTFMGGLALLAR
#> 98            LGHFHAERVMALAETLGGCKDLKINIMDYRR
#> 99               VDNIPKNWGCGALLFVATLVAARVHLPR
#> 100                                 VCFTKGELR
#> 101                        VELLFLYLNATINSPCFR
#> 102                             QFLGCNDVLIAKR
#> 103              KLLDKTEMYWHFNESNFLKLLLCIIDKK
#> 104                          CNEILGARLNTIHNLR
#> 105                    NSNGHSCDIMLAPRLGAEQMQK
#> 106                    VLFIYALAGLVTVCGCIILALR
#> 107                    VLFIYALAGLVTVCGCIILALR
#> 108                                ELRSLAQRCR
#> 109                    PTFSTERKFFKCFRDVEGFGLR
#> 110                     YDIEVVGEATFRCFKRRRFYR
#> 111                          HACLIYGARAVATSCR
#> 112                          HACLIYGARAVATSCR
#> 113  ITFVGIFDTVASSYHPSLNIRLQDDCAERVLHLTALDEVR
#> 114              PLAMQDFHHQPLLGLYCPQYRQLLRLEK
#> 115      LIEKAHIEIDTAQGQFGGLPQHIMVRSNPLCIRKGK
#> 116                          RVLFNLARQTDMLCLR
#> 117                QRLRNFVHVDLIQGLVYAMFSACAIR
#> 118                      QEVESCTTIEKIWVIDLKIK
#> 119                           LWCKAQIAELLLSVR
#> 120              LGRSCFTGSDVPERDEYLQESLVADVGR
#> 121                         VGDSLPDALCTTLSTVR
#> 122                   ATLVRGNTLAEIAREFELGECLR
#> 123               SKEDLLDIKNLVILPEVELTECAVLYR
#> 124                               RFAIEELCAVK
#> 125                         DFLTSQCASKPIKMGTR
#> 126                     KQLELKPPDSLDCVEGDIRAR
#> 127                              ECGTPSDAGKLR
#> 128                            VGSRCAKVAGRLFR
#> 129                   KRGVNFDLYQQKLVKNGTPCIAR
#> 130               EIRGVPLTTSDDPLLSSLPCFEIHRQR
#> 131                   AKDVAFEPLARLLAQTYPHCPAR
#> 132             LALYTACGGISPAYTLPVVLDVGTNNPQR
#> 133                VFELQFAHKAQFVELLERTFFRYCNR
#> 134                            NLIGEAFFCRILRR
#> 135                      LRNFCQRPSVIGLALYPSLK
#> 136                              GVCVLKMRCPQR
#> 137                              GVCVLKMRCPQR
#> 138                           PARLYQGLEAFCPLR
#> 139             VGAIPTLDVCTGNNWLEVQDRAEKKLALK
#> 140                  KGRCGRVAAGVCIRLYSEQDFLSR
#> 141                  KGRCGRVAAGVCIRLYSEQDFLSR
#> 142                            RCLVQVTRELEKER
#> 143                   QGAQALEVLLQNIKEQSLRHCGR
#> 144                      RRKTWYLITLLCPLCTSSRR
#> 145                      RRKTWYLITLLCPLCTSSRR
#> 146        PFGLINRHIFLSQMSRPFYRELYDKKSCIAFMDK
#> 147                     DSLSKDLAIQLRKKNCIDGTR
#> 148                 KDAETRMDKCVEAFKNQINRIRTGR
#> 149                GKDINSAENIRRDVAKIIDECTFPIR
#> 150                   ARRDHACVHRTILGKEELQDLTR
#> 151       MVDKVGERHLLSPKGHCNTCTLQQQNHPNVASAHK
#> 152       MVDKVGERHLLSPKGHCNTCTLQQQNHPNVASAHK
#> 153   GPIPPVIASAGTAFVLKHYDYRDTGCVVQQANRDIATVR
#> 154               KNSELNQRRLAATPRGVGVMCDFYAER
#> 155                                DLCIKTKTAR
#> 156                     RWSPCPDVASLVEHIQTLRVR
#> 157                     KAQAAIADLDDLTRYVLCGPR
#> 158                          RTRYPNIVDQMDLHCR
#> 159                     DSLSKDLAIQLRKKNCIDGTR
#> 160                                CRNIVMNNIR
#> 161                          CLANIADAEEIATHDK
#> 162                   YIAGSDLLNWQLAEALAKCLTGK
#> 163                    CAIGAETLRGEIEALIKQIMEK
#> 164                                  RICSAILR
#> 165                            VRCFGVPLVRIDVR
#> 166                    WELVGAFSPDRQKTQRICQHYR
#> 167      QRSESLEQQREAVDKRKEAIAEQRKEALGADTCHNK
#> 168                                 SCALITDGR
#> 169                         KVATIIGLVDKPCARKK
#> 170                             QRLDCGIEQYQKK
#> 171             KRMQRWLAQCDALGLSVDALLPDACVLPK
#> 172             KRMQRWLAQCDALGLSVDALLPDACVLPK
#> 173                    CAIGAETLRGEIEALIKQIMEK
#> 174                      VQMITVHKPCISQIEELLQR
#> 175                         SACLMPRNSALHTVLRR
#> 176            QRHQKCELDWFACDLANRAASAPLITQLAK
#> 177            QRHQKCELDWFACDLANRAASAPLITQLAK
#> 178                            LTYVWCTAPWSLWR
#> 179                        AKCSKGKIKGKQLQQLAR
#> 180                                 RRCLVQVTR
#> 181                         SVADSLQQCLLSGRNRR
#> 182                          VPKRSQIPKLLCAALR
#> 183                              RVICEGHLGRAR
#> 184                     QSGFVYCVNDVLNTFNPQMAR
#> 185                     TLCESGVDSLQRIALAQALSR
#> 186                                   RRVALCR
#> 187                             KVQQVVISNCLLR
#> 188                        AKCSKGKIKGKQLQQLAR
#> 189               HDVFENNQVINLEHKYCINTIKAILGK
#> 190                                 VCFTKGELR
#> 191                            KNFGVGKGIVVCEK
#> 192                   AEHESLHKEAQECQFHWIREALR
#> 193                            KVRVCFTKGELRER
#> 194                     IRFPELVGFVEKGVGCAQSLK
#> 195                            LPALCQLVASAAQR
#> 196                           PDLYTRATFTLLKCR
#> 197                        YIDMLIPRGGAGLHKLCR
#> 198             TSAFGPFQSLCFLYGAIFVLITMLLPFHR
#> 199                       KATLDTLALYLACGIDPKK
#> 200                        ALTLYGIKNCDTIKKARR
#> 201                LVVRWVSSCYLDMDDVIAPYRTRRGR
#> 202                LVVRWVSSCYLDMDDVIAPYRTRRGR
#> 203                         CVPNLREVLTPLEIRIV
#> 204                 CMLPATKDETKVVTLRPLGQLGQAK
#> 205            DVFIDLICYRRHGHNEADEPSATQPMMYQK
#> 206     IIKIQPDSAIGEAFGKKRNIAVSAGVTGQLEVVNCPK
#> 207          RILHSQDSLGVSAAVDAACHGSRLLQKAADLR
#> 208                 LYSCTFSSSFEANEHQKFTGLPNKK
#> 209         VYLNAANGLGVSPAQCVTLEDSVNGMIATKAAR
#> 210                            QRICITLALLGKTR
#> 211                         AVGLPLDRTELYRRCLR
#> 212                                CNLKVKRSLR
#> 213                                 DKFLCRKNK
#> 214                             ELRYNLRRCVTDR
#> 215         RCPFCDVAHGRPLTPDANEPEKLAQTIHDMGLR
#> 216         RCPFCDVAHGRPLTPDANEPEKLAQTIHDMGLR
#> 217                                 VRQCFIRLR
#> 218                     YAELAIPTVLMLKRVFCLTLR
#> 219                         ECGRERRVHRRLQVVIR
#> 220                      ESLPIHDYWAQQLQGCWDAR
#> 221                              RDRGGSCLKKLR
#> 222            QWQTIDPPPPCGTLLFVSAILLPLTVLTSK
#> 223    KGVAGFRMEAYTIASVVIRDRRLTCQQLKEIVASPHER
#> 224                            MDAECIVTMGLNKR
#> 225                             WEFIQGSQSCRIK
#> 226                YCAKHQFHNGDIIRGTLSILSYLYKK
#> 227                        PAVCAGLKPRADMCFSHR
#> 228                        PAVCAGLKPRADMCFSHR
#> 229                 YLHRLARKDLALNQAMIPLGSCTMK
#> 230                       QYCSFERELEPPVQTTRLR
#> 231                       ALECIFPLREKLKKEGLHR
#> 232                    EKCLTFFLERQARTIGVYALRR
#> 233                      MDLTQLRMFCLVAETGSVAR
#> 234                     LGICDQQLVWISSRRGKVISR
#> 235                          CLANIADAEEIATHDK
#> 236           VKADLRNEKIGFKIREHTLRRVPYMLVCGDK
#> 237                      CLSLWGTIRLMLLVRSITER
#> 238                 LGLEVKESGELIGTCVLFNLEIESK
#> 239              VTGVPCDMIVAIEEYSLGDLERLTIALR
#> 240                LPALFCFPQILQHRLRSINAAFKQAR
#> 241                              RKQLCRINDNIR
#> 242                            FRPNSKCIVYVRGR
#> 243         ATGVVTPAAYQELFLLRKSATGSWQTARYCTSK
#> 244                         SACGSLVLVGILLLGRR
#> 245                            IFLAYGDLCWSSLR
#> 246                            YLVVCLVRPLNDLR
#> 247              PVCLRIVLGCPEGNDAEIHGGHALVVKR
#> 248              PVCLRIVLGCPEGNDAEIHGGHALVVKR
#> 249                        FVESCRQRVKKMKELAGR
#> 250    KGVAGFRMEAYTIASVVIRDRRLTCQQLKEIVASPHER
#> 251                      QLLTQDKAAVVFGCWTSVSR
#> 252            DLKNVNSFYCFLVLISMCIEGVYRFWLSHK
#> 253            DLKNVNSFYCFLVLISMCIEGVYRFWLSHK
#> 254          KLFDICRGLPEGAEITIMLDGDRMLVRSGRSR
#> 255                                  RAQNCKER
#> 256                                  RCTQNLKR
#> 257                QPTQQIGACTYLTVPVTVSKVLVVLK
#> 258                         TSEQRVDIRVLPVGFCR
#> 259                AIEVCNRHEPAWGTRIKLTVPVDVAK
#> 260               MTCRELKAALREARETNTAQQRVLTDK
#> 261                 VEGRGSWRVLLPTFPQLCGKLSSRR
#> 262                 KMRSEPYGHVFGTQSCGRCLYIAVK
#> 263                 KMRSEPYGHVFGTQSCGRCLYIAVK
#> 264                       AISCNNRLDELNQIRHSLR
#> 265                            RRAEFLAGRCLAKR
#> 266                          CGICRAQQVHIFDKER
#> 267                          CGICRAQQVHIFDKER
#> 268                               QRLLALLRACR
#> 269                           WKVLRTCIRSIEGLR
#> 270                            GVTDVYYGRCWFER
#> 271                         KAISKMLNTCYRILGLK
#> 272                      QVAYTVSSLNACGTDLIVVK
#> 273                        VCDYLPDIEQNIYRSALR
#> 274                            QTKPCQLLIEKLWR
#> 275                            ERLEGKTFCVRVKR
#> 276                              RRVALCRLLLEK
#> 277                         LCCYASPEYLATCPPPR
#> 278                         LCCYASPEYLATCPPPR
#> 279                         LCCYASPEYLATCPPPR
#> 280                   KDGIYACSSSHQILDKVEKASLK
#> 281          LDTAIQRHSVRWEWVKGHAGHPENERCDELAR
#> 282                 LACMLLKLQGRSLMDEVAVGSTRIR
#> 283                IVCREVLNADIYAAILTSVAQSIIGK
#> 284                        DIGCVLSLIKNTKELRFR
#> 285                         IILGCTELPLILEQEVR
#> 286                     SEILRAEASGQLAQCFKEARR
#> 287                            QCQRTANRADDVQR
#> 288                    KVGYKSRSQKRDKVGSCDLAGR
#> 289                           EQRIIQMALCLLEKR
#> 290                             RANLLCMYRGLGR
#> 291                              KVKDACLLPLLR
#> 292                                    RCERVR
#> 293                            QLATNQKMILVCGR
#> 294                                 CRFALEIVR
#> 295                                 RQDCISHGR
#> 296                                  RCSLLTRK
#> 297                          CSKGKIKGKQLQQLAR
#> 298                                   RRYICPR
#> 299                         DEIFLTETTCDIAYHWR
#> 300                   ELPLMLSVTLLCGVLLHDSYLSR
#> 301               GKIECNLRFELDPSAQSALILNEKLAK
#> 302                DIFNLLRCKQYGLNPSIEINSIIIPK
#> 303                EAAGKPCNVVELQGTVGASVAINRKK
#> 304                           LCLREAITQQTLGLR
#> 305                               RFAIEELCAVK
#> 306                         CSKGKIKGKQLQQLARK
#> 307                            VGSRCAKVAGRLFR
#> 308                             LITCKFTTKKRMR
#> 309                               FRAAYDLLCLR
#> 310                   CNTVFIRRVFLGSCATKLGKNPK
#> 311                   CNTVFIRRVFLGSCATKLGKNPK
#> 312                  TDPDCYLLAKPRAGQPSGGMQLLR
#> 313                             EYTVGYFLSCLSR
#> 314                   ICNRYKGSASFLSGAAIQIGAKR
#> 315           GIAWILCDVTQSQGNELELTLSGDANKVIAK
#> 316                           KNTLGKLRVFRAFCR
#> 317                     RLCDEDLQDKHQELFAVLAER
#> 318                            CLMRVLRKIFSINR
#> 319                         SLKAISDQCSTKVIVVR
#> 320                 FEAHRLTMAQSEWRRMKNNNSQECR
#> 321                                KLENVCYDIR
#> 322              KGASADNQCARASIMMGRIYMAQQDYSR
#> 323                        GVCAGLARYFDVPVKLLR
#> 324                     GIMQCLIRRFYEHRTYSLFSR
#> 325                       EPCPLPGKNELEEAAARLK
#> 326                                   KACFELR
#> 327                     ISLVFHSLYCIPDNELSRLRR
#> 328                            QCQRTANRADDVQR
#> 329                       EISACAAMLKNLPVVVQRR
#> 330  SSCYGQVQRIADSLDTNSKLLSPLDIINKISLGAPIEFTR
#> 331                       EGDVFCGDGVCIVRLGGLR
#> 332                       EGDVFCGDGVCIVRLGGLR
#> 333                                  EYCDLLRR
#> 334      LRQIALDARESAQLMEQCHILYREGAFTLNLQRTTR
#> 335                          KLCRNCKIVKRNGVVR
#> 336                          KLCRNCKIVKRNGVVR
#> 337                   HPITVLRWEQLFTQCIIGVREVR
#> 338                               VAKRCLKSIER
#> 339                                 LACEICRDR
#> 340                                 LACEICRDR
#> 341                WGAEALFRAKAIFKGGAIDLEIVCKR
#> 342                                 TTFKCTILR
#> 343                      WPACAFIIMTTLMVWIAGER
#> 344                          RMLLAMVEDFRCVVIK
#> 345                     LRCASIQKFGERALKAWSVAR
#> 346                      IALLFNVCEKEQRSLALLVR
#> 347                              ACDIKKVSNLKR
#> 348                    HNGGAKHGYLATTANRTCARCR
#> 349                    HNGGAKHGYLATTANRTCARCR
#> 350       AGPAIYAHGPLVREGDEAEKVTIQCLKNLREAFSK
#> 351                             IDLICEHAVRGDR
#> 352                            AMQQWHHYQNCHVR
#> 353                               KVRASVKKLCR
#> 354                        NILLISECNKRALVETRR
#> 355                           EVIKCFLKLWRIELK
#> 356                         RRRRVKRKSGNIDDFCR
#> 357                        DTNRSNCILGGLRVKGTK
#> 358            LSPHGVPLMLVLFGIGTVVGNVIGGRLCDR
#> 359                        AVPKRRAEFLAGRCLAKR
#> 360                 EVNKPEINYAAIEELVCADLSLYYK
#> 361                           TLCPQLRPVVIIGGR
#> 362              IRRQVVVPLNKLMAACASIEKGRFTHSR
#> 363                            WLCSGGKKAVLDLR
#> 364                                 KITEKCKRR
#> 365                         SQCHPCWYFPRSSLMTR
#> 366                         SQCHPCWYFPRSSLMTR
#> 367                          ETKLRKLSRECAQIAK
#> 368                              RRVALCRLLLEK
#> 369                            CLALIEDPTKVLPK
#> 370                                 VNRCFFFNR
#> 371                     GYTRKQVRLLCEWYLRVRKSS
#> 372                             CPFVLLSLLHLVR
#> 373       AGPAIYAHGPLVREGDEAEKVTIQCLKNLREAFSK
#> 374                    KGKDRDGGCGFVCWLKGQCHLR
#> 375                    KGKDRDGGCGFVCWLKGQCHLR
#> 376                    KGKDRDGGCGFVCWLKGQCHLR
#> 377              RDKVGSCDLAGRVTHYRVGPLDKVRGGR
#> 378                      LCIGVLVVSQTRQKIESSLR
#> 379                                 RCIEIKRAR
#> 380                    ECGMILDLNRLGIDFDIVVTKK
#> 381             GRFGPCVELPAFPYKVTVDGAQWITKFLK
#> 382             QCGHHFEAEGVKVIEFAQSGLRPLLKFAR
#> 383                       YAPCTNICAGCRICRLIDR
#> 384                       YAPCTNICAGCRICRLIDR
#> 385                       YAPCTNICAGCRICRLIDR
#> 386                       YAPCTNICAGCRICRLIDR
#> 387                      LGLTQQTIAERLCLKITTVR
#> 388                                QAKQVDYDCK
#> 389                                ELVATDEYCR
#> 390                   STQVLITHKPALLSCANKLLVLR
#> 391                            LRPVLNLILGLGCR
#> 392                               FKLCKFKKANR
#> 393                    LHCQGKLWCVFGCGGDRDKGKR
#> 394                    LHCQGKLWCVFGCGGDRDKGKR
#> 395                    LHCQGKLWCVFGCGGDRDKGKR
#> 396                                 RWGVCAQER
#> 397                         WDDSQENLEECIRYAER
#> 398                             RLLCVTRWVLALR
#> 399                        FDFCERYCFIMHYRNGVK
#> 400                        FDFCERYCFIMHYRNGVK
#> 401                                RASMKCFRIK
#> 402                   TYRTPEIHQQCLTEADDVYDSFR
#> 403                             YPDSKKECLRIVK
#> 404                                 QCWQDGGRK
#> 405                      VMLKVEELRQSLRILDQCLK
#> 406        MKKVTVAATQMACSWDLPKNIENAEKLVRQAHAK
#> 407                         NNEEQLHEICHFMNQER
#> 408                         NNEEQLHEICHFMNQER
#> 409  GVMMVRQGKGNKDRVVPLGERACKWLARYLNHARPALARR
#> 410  GVMMVRQGKGNKDRVVPLGERACKWLARYLNHARPALARR
#> 411   ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK
#> 412   ICSAILRIISPEWWGRKLWRLRCEWRENQFRAIGVIHKK
#> 413                             CPFVLLSLLHLVR
#> 414                       NATTVWIVTYCLSILLVKR
#> 415                        ALARPLVKIAPQELVCAK
#> 416  PQFTFPVAMLSCLILMRHHDNIQRLWRGQESKIWDKLRKK
#> 417                            CSCSPHFATEAHTR
#> 418                            CSCSPHFATEAHTR
#> 419                              ETDSMCATQMER
#> 420                           AEVRCPKKRIVRLIK
#> 421                            MASCSSASGTVGCR
#> 422                            MASCSSASGTVGCR
#> 423                            ACAYRDPEEKEEER
#> 424                            ACAYRDPEEKEEER
#> 425       PVQIQAGEDSNVIGALGGAVLGGFLGNTIGGGSGR
#> 426              TQVLDGLINANDIEVPVALIDGEIDVLR
#> 427         TKGLNVMQNLLTAHPDVQAVFAQNDEMALGALR
#> 428               SQILQQAGTSVLSQANQVPQTVLSLLR
#> 429       PIIGDNPFVVVLPDVVLDESTADQTQENLALLISR
#> 430                   WTSQSSLDLGEPLSLITESVFAR
#> 431               SQILQQAGTSVLSQANQVPQTVLSLLR
#> 432                       FESTITNLNNSINNLSSAR
#> 433               SQILQQAGTSVLSQANQVPQTVLSLLR
#> 434                       VFMQPASEGTGIIAGGAMR
#> 435                      IQGIGAGFIPGNLDLELIDR
#> 436              TQVLDGLINANDIEVPVALIDGEIDVLR
#> 437                           IEDADYATEVSNMSR
#> 438                   WTSQSSLDLGEPLSLITESVFAR
#> 439                              THSQEEMQHMQR
#> 440                          VGFFNPIATGQAEALR
#> 441                          AGGGSATLSMGQAAAR
#> 442                           TTINFDNAIIAAGSR
#> 443                              THSQEEMQHMQR
#> 444         TKGLNVMQNLLTAHPDVQAVFAQNDEMALGALR
#> 445                          MVVTLIHPIAMDDGLR
#> 446                          MVVTLIHPIAMDDGLR
#> 447                            IATDPFVGNLTFFR
#> 448                   LGTGANVYLASAELAAVASLLGR
#> 449                         IIELAGYLDSYIPEPER
#> 450                         IIELAGYLDSYIPEPER
#> 451                              IHTEEDERPIGR
#> 452                              VDQLSNDVNAIR
#> 453                              SDLFNVNAGIVR
#> 454                               PAVNPGISVSR
#> 455                               LESLVEELVNR
#> 456                             PIQLPFIPHDDPR
#> 457                               LFGVTTLDIIR
#> 458                               SQSALGTAIER
#> 459                              LLSYVDDEAFIR
#> 460                          TGLQTLPLDALNSLLR
#> 461                                  VATVSLPR
#> 462                               VAAAFPGDVDR
#> 463                              VGNLAFLDVTGR
#> 464                          ITTVQAAIDFIQANQQ
#> 465                                IDELPFDFIR
#> 466                 SQGREDIWRQTVDDIRRKLNENQQR
#> 467                       VHAQYAGHPIAFDDRYGDR
#> 468                       KVKSRANWPVQVMWDIYSR
#> 469                           ENLQSILDQLLSNLR
#> 470                              KEIERLARLVKK
#> 471                      QIKEIGAKVAPPVQENRLLK
#> 472                                    RMRRIR
#> 473                           GVRYADEVVRTKEAK
#> 474                   QLIDAAAQTLLNKGILKFQNDRR
#> 475                   QLIDAAAQTLLNKGILKFQNDRR
#> 476                                  HLWMHQKR
#> 477                                 KEQKSLLKR
#> 478                               KQRLFFRKSRR
#> 479                            QLLERYSIAREQFR
#> 480                                    RMRRIR
#> 481                 SDRKEKAKLYNLKNQAGAIKQELTK
#> 482                      QLSDAASATRLNRLQEAQEK
#> 483                         QNMDLKAAEVEAQAAER
#> 484                              REVIDWLRQRSR
#> 485                            GQSSSDQGVRAYVR
#> 486                         ETRQYEEKVWKEALQRR
#> 487                                  RTGQESIR
#> 488                                  RAFRILNR
#> 489                       LSDVKIVDDATRQDIPSLR
#> 490                                 LLRRRWPPR
#> 491                            EVWEGVTESTNLKR
#> 492                            ASVGETFVLKLDVR
#> 493                   QLIDAAAQTLLNKGILKFQNDRR
#> 494             ERLQSKLEDAQVQLENNRLEQELVLMAQR
#> 495                            LSGTVVVGETPVIR
#> 496                              RIGEEQKALLIR
#> 497            ESENKIEETRSRYRSEALSQLSEAQTNLNK
#> 498                            EQGLRLLALTDDIR
#> 499                             EVFNIQERRMIKR
#> 500                                RLHEQPMRAR
#> 501                         IIELAGYLDSYIPEPER
#> 502                         IIELAGYLDSYIPEPER
#> 503                           ERGDIRPEGALVRGR
#> 504                            HRQQKREIDLPYYR
#> 505                         QRPIDEKEHWEKLLQQR
#> 506                            ASVGETFVLKLDVR
#> 507                        EVDLGRAAVDTAILIDLR
#> 508                                 RRFIIEAWR
#> 509                          HRTFHHGLLIYTGPLR
#> 510                              HGAQKRYHKRRR
#> 511                                 NRWWLLRRK
#> 512                              RSIDNIPAQALR
#> 513            GDFSKASLGRFDRIRPVAISILRELFEWMR
#> 514                         FVLQGLETPELGRGKRK
#> 515                                IRQLNHRLAR
#> 516                                RLASSPLLNR
#> 517                                 RKEQRLMVR
#> 518                         MAGLAREVRLQNIADLR
#> 519                              RAGREIIVGVQR
#> 520                               LKDWIKSEQGR
#> 521                                 RSLYDLRKR
#> 522                    VREAIRRVYERSGGPVVMWQPR
#> 523                            MNSMFWRLVFRALR
#> 524                                 RDSKAQAIR
#> 525                     MQGVIQARESKYIMLHAPSER
#> 526                         ALTDFTLELAARVHEIR
#> 527                           EYAIVDLRVFNVFSR
#> 528                                RFFANVIHPR
#> 529                             QWSLTTDLIDGVR
#> 530                 LPIERQQEMQTLFQQVMPADMREDK
#> 531                         EETQVGLWGERGPFPAR
#> 532                             AGVEAGRTLREFR
#> 533                    KYIIKASSESHKKFLENYIDKK
#> 534              ADVENRDSVQRLVLAFHNGRLTGIRLKR
#> 535                                RAEADWLSLR
#> 536                          LPHYVDFQSELELLKR
#> 537            YYWAGGGGLPTDGVPVPDRASIEMVSLYDR
#> 538            YYWAGGGGLPTDGVPVPDRASIEMVSLYDR
#> 539                     MASFILVIKQPHHPVHRAEER
#> 540                       KVKSRANWPVQVMWDIYSR
#> 541        ITTLRKERGITQAELAEKLGVSQQTVQAWEAGRR
#> 542                               RIITDAIFDKR
#> 543                                  RFLSRLER
#> 544                    DNLQRAAFATLRAHGQALNLKK
#> 545                       RIKDSRIQQRISQVDLAER
#> 546                 VLRASRPVAETWLLDAQQRGLTLSR
#> 547                       FAQFLQSQQLEAIGIGTDR
#> 548                          RYNPRDVLGIKGAISR
#> 549            EGLFQAAEGGTLFLDEIGDMPLSLQVKLLR
#> 550                           EKVQVILTEGDRLVR
#> 551                         DVKLVKFDNYWQKGWPK
#> 552                                 RRFANLADR
#> 553                                   REVLAIR
#> 554                                    RFMVRR
#> 555                                    RYNLTR
#> 556                                  ASKDGILR
#> 557                                 RSSVWVLSR
#> 558                                   RERRQPR
#> 559                        ERLDPSEYINIKSQFVLR
#> 560                                   RLNRRYR
#> 561                              KTSSAIMTLAAR
#> 562                          ETIIVHEIPYQVNKAR
#> 563                             RTSIILKDTIFVR
#> 564                                 RRQILMWRR
#> 565             KVPAFSRRHFETAGLAALKELHFATPYGK
#> 566                QRALLDVLLHLESQLGDVSQMTVPSR
#> 567               TLKARRNQPMLMVDIAVPRDIEPEVGK
#> 568                    EGKIRYIGLSEASVTTLERAHR
#> 569                             EGFRFDPVTEADR
#> 570                         EKVMAMLDVVRIRQPER
#> 571                            QLKDATRIYFMMFR
#> 572                        RTRYQMEVRPALWRLGLR
#> 573                KAVTKAMVKSSKDAIIADGGNPDARR
#> 574                          LGHPVREQFKKKLAER
#> 575                              ELPELTEEFIKR
#> 576                                YLSQRVIDDK
#> 577                                RSRNNRFVRR
#> 578                               QLANVVVEDSR
#> 579              AKQQVKYQLDWQVYDLDWSVTYQYLGSR
#> 580                          QKVEDKQSAIALSKKR
#> 581                     RDLAVYPSVPLGVAQWVQKTR
#> 582                          EDIVLTRDFDKLNYIR
#> 583                           NLSRPVPQLLAADYR
#> 584               EPQASAPYDKAQLLLTPTKLHSPTWQR
#> 585                               RLYRVRRDIQR
#> 586                      ELVEDIINRQPRITERDDAR
#> 587                                REPRAERQRR
#> 588                                   LWRVLPK
#> 589                              QKEGRSLVEVPR
#> 590                                  RRYQILER
#> 591                      SSAGGLLESPDIGDELLKAR
#> 592                              QTWMFGKGIFLR
#> 593                      MWEFLERLISIAVPRIRDFR
#> 594                     IYKVVFNVLTGKATSLQDGMR
#> 595                               NTKEVLALAQR
#> 596                        AEDIPMLANHLLRESANR
#> 597                         NQAGAIKQELTKKIEPR
#> 598                            RSIIRVKEGRRLDR
#> 599                       GADIQDYLQARIIRRQSNR
#> 600                             EPHAFMLPRGQTK
#> 601                        ATYIVVHDGMGKILVQRR
#> 602            DIAETYNVSRSVVREALIMLELEKLIEVRK
#> 603                               RNALQEIPVYR
#> 604                         NFVLKWDAATLPTRAKK
#> 605                                   AEKKKNK
#> 606                           MRLDKFLSQQLEISR
#> 607                           FWRLNEELTESGIFR
#> 608                  LPLVFLVQYIVVPFQAYFVWYLSR
#> 609                              RKAMEMMRPSLK
#> 610                            RAIMARFKALLEQR
#> 611                GNTRSTELLAVGNPADLAIEAIRSLR
#> 612                      KFDLITFWLKGYKENIRTGR
#> 613                               TQSERFEPLSR
#> 614                     QVMSSKQKQRETLEQQLQGLR
#> 615                           KVTIFGAQRLLDVHR
#> 616                              FVKAEMKYLENR
#> 617                       YKITFVFPENVIDRMANNR
#> 618                         NVERLLRITNSSKNVLK
#> 619                          QIIDYAFAHQGPVYIR
#> 620                             TIRDQLLYLRQKK
#> 621                 DGRLLSGRQWSLDMLRIVDWYGFSR
#> 622              LALNERAPYAFNVQRFELEGKAREIERK
#> 623                                  RDRISTIR
#> 624                            RLMQAYMDPTVGLR
#> 625                                   RFAFIAR
#> 626         RNLLEEELVNEGIIGLDVVGDMVLGPIDDDRVR
#> 627                            EVRSLAVTSVRYRR
#> 628                              FRLRIESVGRTR
#> 629                             RTASQLQNQVQQR
#> 630                        EIRKAMDYIIKPNIEWGR
#> 631                         QRPIDEKEHWEKLLQQR
#> 632                      ELLIDESLIGWKEYEMEVVR
#> 633                                 RKFLKGQLR
#> 634                              RLFMARRRIEKR
#> 635                                    RVYTDR
#> 636                       MANLMLKRSRIVRVDSLDR
#> 637                              PSFTELEEHIRR
#> 638                           EKKLREQPTQWKLLR
#> 639                      RLVAYLLAQPDTVLEPADLR
#> 640                              FQRQVGSISARR
#> 641                                RTSPYSQYLR
#> 642                     KKASAFRASAEDWNLVNWFAK
#> 643                               RMRRDVNERGR
#> 644                          ELREQATVALMFLTGR
#> 645                                  RIRWKIFR
#> 646           LIERDEINRLAVDDIEGAQHQLRAQKIAAPR
#> 647                                  RSLVFERR
#> 648                                 RHGTVLILK
#> 649                           QPLYRDIDNTGVLLR
#> 650                               DELYTVVLALR
#> 651                                    RLTRWR
#> 652                        IDRWLFSILHSIWISELR
#> 653                                   RYRVIAR
#> 654                              VNDPLLKLLQAR
#> 655                     LEGNDVVVTALGGAGNRTGMR
#> 656                         EVENTLVQKALSHPNIR
#> 657                    KLHADDRIARGALITLTSRALR
#> 658                    KLHADDRIARGALITLTSRALR
#> 659                         KAVDNRFEVITRMLKER
#> 660                                 RVSPIFTIR
#> 661                     NSRLYFQDQYHDIGYEHDKRR
#> 662                            KEVGDHQLWGILGR
#> 663                         KTLTTVLVRENIAARLR
#> 664             QKMSGSGETFRGRAALVMIDGIPQSNPLR
#> 665                   LLMLFLNIFDLYLTLAGVISYKR
#> 666                     LEGNDVVVTALGGAGNRTGMR
#> 667            VAIVQTTAALGVGSVSLLWTAAASQLLRRR
#> 668                        EQSVENFVLVPFKADERK
#> 669                   EDMLPRENFRPGDRIRGVLYSVR
#> 670                        ERLDPSEYINIKSQFVLR
#> 671                         ENTKAIIRKEILEKIGR
#> 672                         ENTKAIIRKEILEKIGR
#> 673                                QTKALHQLLR
#> 674      YRNVDTVESAIPLYTVQNIVTHANDWYQPNRELVMK
#> 675                               LDELAKLLIQR
#> 676                        DGMIVNVLLEALPDLKLR
#> 677                                 RVFLAQIGR
#> 678                        IAVVHRQSSLKAAIPSIR
#> 679                    EYFIAVDRAELGRNTGARFKAK
#> 680                         QLELELGTDLFIREKQR
#> 681                                QFYPEAQLAK
#> 682                                  RWNEYLVR
#> 683                                   RIFRRLR
#> 684                         ALTDFTLELAARVHEIR
#> 685                               HHRLQALALLR
#> 686                           LYVLNAKLLGQKVDK
#> 687                           VLRLVEQTIADASFR
#> 688                        GTGKQRWPKKGSGTVEAR
#> 689                        EDLYYRLNVMPLALPPLR
#> 690                                  RKMMTLVR
#> 691                           KENDVIERQLKNKRR
#> 692                              VTQVVSLPFRLR
#> 693                         EVLALPWLVTFTLDQWR
#> 694                           KRSALRSLHEQLRLK
#> 695                             EVFNIQERRMIKR
#> 696                     QEDRIAQEAARQEQAALTGWR
#> 697                               RERSLRRLQQR
#> 698                                    RQMLIR
#> 699                         AAERSVFYHSTGHAGYR
#> 700                                    RKMLIR
#> 701                   AGETRPFVSMAKMDLSGLGKITR
#> 702                          DATIRASHPHLQLLAR
#> 703                                 RAILFYIAR
#> 704                  NVLEKGTQDPVIVDVSFREQIRQR
#> 705                                RFAGLKERRR
#> 706                                  TYSLWDRR
#> 707                         EPKAFIKHGRNIRSAPR
#> 708                   NNPNFAIRGIDANGKAIGLGTLR
#> 709                                ERPTLLQIDR
#> 710                    KKAWDYLYEPDPKSLLDTLLRR
#> 711                                   RFEKTAR
#> 712                               RQARGIAIRQR
#> 713                       ELSELIGVTRTTLREVLQR
#> 714                            RIVVNYAKRQQGRR
#> 715                              MRALELGRPLVR
#> 716                             EVNQMANKLGVHR
#> 717                    AELYHLRATQQISNETLQKMLR
#> 718                                RFGSDKPDLR
#> 719                                  KTQPQYYR
#> 720                             EEDRPDLPKSNRR
#> 721                    IFGSRNDRTLRRMRKNVDVISR
#> 722    YYLDERFENKEMAKPLDRHTASIIRVDIDLDRNSGLPR
#> 723                             VFRYYVPKQKSVK
#> 724                       QLLMVLLDNIPEKPDAPKR
#> 725                       KEPKRATLNVSFFASPLQR
#> 726               KTPQTLQAQLKGDNTLIMLGESDRDLR
#> 727                             QQRDKEKTQLLRR
#> 728                              DEVVELWDYLVR
#> 729              QRIWQRLNLPSPAVLETAYTLSLDTPDR
#> 730                           EQLVFSWLNSLSPLK
#> 731                                    WLRRDR
#> 732                    AEKTRVVEDAYRVGKGKYPEPR
#> 733                            QINRLLNWHWKLSR
#> 734                                IDVFVIKAGR
#> 735                              RSDMQLRVIPTK
#> 736                                 KRIFNHLKK
#> 737                          ESIPVVDADLFFVLLR
#> 738                                 RWTPQQKQR
#> 739                    PLPLASYSARRANGTLATNMLR
#> 740                                  RRFSDFQR
#> 741                     ETLYTFDQLKSNKVELRRPLR
#> 742                       RKQTFEPAIEGATLQWRLR
#> 743                      LYRTHYLQLFRSRFGPVDIK
#> 744             DLAVANGSARKTLMDIMAALGTSDALAAR
#> 745                                   ERRVHRR
#> 746                            RFNLPESLTRRYSR
#> 747                    EFYTRMVIELRDQYQTRLVALR
#> 748                              RMKVQTMSELIR
#> 749                                LQTDELRSAR
#> 750                           RSYVDAARSMALSNR
#> 751     RQANAIAKTVWPHEIAEGPKMGLKRMMNSVRDSAFIR
#> 752                                  RSFRVQTK
#> 753                        EDRQHLKKNPYDYRAKFR
#> 754                         YVSRGAVREMPLTPRQR
#> 755                         KRGERIAVTNLRSPDEI
#> 756                               TQQESLQKALR
#> 757                              LTGPLLEHPRAR
#> 758                   EHLAAAAQGSLGLLQQYSYQRDR
#> 759                     EADDRKQRSESLEQQREAVDK
#> 760              ETADNLKKSGAFVPGIRPGEQTAKYIDK
#> 761                     KVWHLPDGYHWMEPLPLLHRR
#> 762                           ITLALDVWQSLLHGR
#> 763               AVEQGIDLVPVLADSTSTAKISPFIQR
#> 764                                 GTAKLYGKR
#> 765                                 AWFTQLKTK
#> 766            QIESFLAMGDMEDMRLDSIVLDFKERTLLR
#> 767                             DIYIGNARFQARR
#> 768                    EVTETVKGRKRVGATDILIYER
#> 769                          NLQRYVKDFGSLMDLR
#> 770                            TIFRDAQNEMTQIR
#> 771                    MVMNILTKIFGSRNDRTLRRMR
#> 772                           LIVVEQFSLEAPKTK
#> 773                           EKRDYYNQVKLKNYR
#> 774                        ELSAIMADLSNGHEHLRR
#> 775                         QGGGNVYSKEVLKMELR
#> 776                               QGGSLQHPYRR
#> 777      HIRTQPQQQMLRQQLRESRRSTQRLQQQMADDLRQR
#> 778                            RQRKRQFRQLWIAR
#> 779                                 RAVDRADLR
#> 780                         TLLEAVRAPIQERPLLR
#> 781                           ELANAILVTFTELLR
#> 782                         QQELTAWLKQQSKLAQR
#> 783                         TQLTERLIRVDRDTIHR
#> 784                                 ETKLRKLSR
#> 785                 VFQGEGFDEYLREIRSLFTKVKIRK
#> 786                            TLAGAGGHIVIVPK
#> 787                           QERSGRDRRNNGQRR
#> 788                      TGADMWGLFVLKSKSSHTIK
#> 789                              QLEYDQLIANLR
#> 790                                  FKLNLGTR
#> 791                               IDHRSIRVQYK
#> 792                    EKMADMAALFMVIPGKDDASAR
#> 793                               KTMILIDNILR
#> 794                                  RGFRRGIR
#> 795          ATLKDIADRAGVSISTVSRALNGTAPISAKVR
#> 796                           EKKELWSLQLALTRR
#> 797                   TQKEYQDYYAFYRDYKDIIIGVR
#> 798                            KTGDSKAELRLSQR
#> 799                             TQKQLSVAVGIIR
#> 800                                   RWLDFLR
#> 801                    KYTNRGLQFLDLIQEGNIGLMK
#> 802                                  RYGLTVVR
#> 803                        FKASANLGLESMAYVIRR
#> 804                           EKKLREQPTQWKLLR
#> 805             NLDIYDLPDYHLTEPLLSKVTRVDTRLER
#> 806                    KTLQDARIVGVEALKVIIANLR
#> 807                             KKIVEKIAYKKTK
#> 808                        IVSDGTDNHLLLIDLSAK
#> 809             QSQQETPATEVTPEELDPRKAAVAAALAR
#> 810                            ILMEVQKYAAMLRR
#> 811                       DIIDLKSESSELRKASSQK
#> 812                                TKGEEAAIKR
#> 813                    LLNLQANSIHLFDMPTYKATQK
#> 814                           HKPFVRTFSTDAMKR
#> 815                    KERLEEVNAELEQPDVWNEPER
#> 816                                RAWDFGAKLR
#> 817                          KMIMAMVQDIRVILIK
#> 818                                  RDWYKEPR
#> 819                STLVKDEYEKLEPIIYREANKLTQRR
#> 820                    NEAADSLENALRLAMSKDGRKR
#> 821                          ATQPIVALFHKASFPR
#> 822           TAQARFRDIYNQLHAVREQQHEYLSQQQALR
#> 823                            ERNEKKWEEAKIRR
#> 824                    KTLGAYDFSFGEGIYTHMKALR
#> 825                 QTNPYLDDVKNKKAPNTNIEVNLEK
#> 826                               YQRQLARAIKR
#> 827                          GNWGSAAWELRSVNQR
#> 828                    LSAENSTLGFYRNLLAISGGLR
#> 829                        EGVPAVEQESQHRKIEQK
#> 830                                    RENYRR
#> 831                         QTNIFTALTAVSFFHQR
#> 832                        QVAHYLKQAAGRAIDVAR
#> 833             YGSGERLVSAFGAQSLHMGAIILEESVAK
#> 834                     DHSVVVLAGEFDILAETLAQR
#> 835                         RMKAGRDSHKIGKIAER
#> 836                               RAETARNELNR
#> 837                                 RSLYIIGHR
#> 838                                QATVWRNDER
#> 839                         RFALTWQGNTLLPFARR
#> 840                       LSRTIASSIGGYLSAEILR
#> 841                      RWRLDIDKIKVADSLLILQR
#> 842                           IPAHRLEGLELVVQR
#> 843                             WNVSLWVKNALDK
#> 844                                  RGELLVRR
#> 845                               IDVVVGGEQWR
#> 846                                  MSKIKIEK
#> 847                QGIITDVVIHDINGHNPHIHIMGTTR
#> 848                       LWSAIESSPLTDNTKLIVR
#> 849                      QEAQEQAQKKSEEQAQLREK
#> 850                        QIKKLWQELGVPPWWRDR
#> 851                       EPFNEDKLRSGMLKALEKR
#> 852                             RLMNATNPKYILR
#> 853                       QSVALSLNNKQAESIELVR
#> 854                                 MARTTPIAR
#> 855                              LLLEVSWEAIER
#> 856                               MIKRVLGLAQR
#> 857                             LTGRNIGMMLAAR
#> 858                    GKAKEQWGKLTDDDLTVIEGKR
#> 859                              RIGEEQKALLIR
#> 860                         KGLFGWFNRKFSSLTER
#> 861                       QSVALSLNNKQAESIELVR
#> 862                           KQDIYILPSRTDLPR
#> 863                                 RRTFRDLIR
#> 864                             KTASRVVYMENGR
#> 865                         QRPIDEKEHWEKLLQQR
#> 866                           GILQRRKEVKDKNSR
#> 867                            MIKREEQSALRRTR
#> 868                        RKDVAERQQELSESRQKR
#> 869                      QELYRQLSVPVAFDEEYNIR
#> 870                                RALFLDVQRR
#> 871                           IGRYSSMIADYRWNR
#> 872                                  EFWQQIQR
#> 873                            KAARIRRATRARRK
#> 874                                 RDIPHADIR
#> 875                   QTALQLIRGMIGDIAQYEKQQAK
#> 876                     LEKPVEFVINEERGQMEVAVK
#> 877                          EWLQMKDWAEITKTRR
#> 878                       KTPQQALDSAVERGNALLR
#> 879                             RRTVPLVMGDNAR
#> 880                       QRNGPIGSVRLTFNGQWSR
#> 881                      ELPKRERVPPKKETVPTVPK
#> 882                         VWPKVDVQWNGNQAMLR
#> 883                                RIAYLSRMRR
#> 884                            ADYRKLRILPEIMR
#> 885                             IDMLVVLGKLSNR
#> 886                                  RWMLIQRR
#> 887                           KRQQTKTLDNQALAR
#> 888                         DTAPGLTTVIKTRRLRR
#> 889                                RRVESLTRWR
#> 890                            LEKQNVSSIVIDLR
#> 891              GWLTAAEAAARIPDAVEKRSALPFVQIK
#> 892                             YHKRRRFKVIKVK
#> 893                             LLQSALRVNQGNR
#> 894                       AAKAASYQLAVLNTAQKDR
#> 895                          QEIRDSLSYLRLISNR
#> 896            VAIVQTTAALGVGSVSLLWTAAASQLLRRR
#> 897                            PLYTKEDLSIDAVR
#> 898                  KGSEITHIEITPAIKQAGSLRGLR
#> 899                    SRGLSRQMYRGADLVKFFNGIK
#> 900                    YSSGMFFFLLFSSALLFALINR
#> 901                                KRELSSIRNR
#> 902                               RMRRDVNERGR
#> 903                                   FLRQLTK
#> 904                                   FLRQLTK
#> 905                              LRDRNFWRITAR
#> 906                           IVASAIVKENLYQIR
#> 907                                   FAYIVRR
#> 908                                REVIDWLRQR
#> 909                             RWLWELPGQRFYR
#> 910                 PKNPEDILWNFEKFLVDREGRVIER
#> 911                               RRFWERLFVGR
#> 912                         VQYTLGEKIFAEDVIKR
#> 913                            YEHHRLVRRLEAVR
#> 914                   EYLGHELAHSLRSIREALAATQR
#> 915                                 RQNSHPFWR
#> 916                                   KMVDLTK
#> 917                                   RYLQKIR
#> 918                           GKTRDYASNMEQRIR
#> 919                     RREYRRLYLHQGIDKGQTQLR
#> 920               QTLEGLLMENEKGYLTELHQNAQRLLK
#> 921               QTLEGLLMENEKGYLTELHQNAQRLLK
#> 922                            KKRLKDWIKSEQGR
#> 923                                 DQNIVAAVR
#> 924                       TMSNVVDTDHTRNAGGVRR
#> 925                             RAVGWIRDNYSTR
#> 926                     TYSEGKRLPWDEQKARYWLER
#> 927                             RLGGRQYYVSLNK
#> 928                                 ETKLRKLSR
#> 929                            QTGRYEYMTRIKER
#> 930                             VTLALRPQDLAIR
#> 931                                   YWRLRYR
#> 932                 EDLMKVYGGLPILAIVFETGTRDRR
#> 933                               VGRKDAKQRIR
#> 934                            GATVLPHGTGRSVR
#> 935                                GVFIREADRR
#> 936                          NAAIRAIASELHVFAR
#> 937          DKTAYLWHIDRFALSFWVEILLLAIPLLLFRR
#> 938                      LTELDYLLGVHDSYRMGGIR
#> 939                                  REARIAHR
#> 940                                 RNEWLLALR
#> 941                                QVDLFLARRR
#> 942                             LEFKLEKVNLRTK
#> 943               LYDRNHEVGYLRTDALARDLEVMAQER
#> 944                    HRTELPIHQHNIIVHRIGEFLR
#> 945                              YHHGLEGKALAR
#> 946                          YVIDPGTARISRYSFR
#> 947                               KGRTARWNRLR
#> 948                                 QSVMRLLGR
#> 949               YITNEVQEVYRLQGVKINDKHIEVIVR
#> 950                               EDYWWYRDLRR
#> 951                                ILLALERRRR
#> 952                          QPLRLRRDLSDDEKQR
#> 953                      ASIGTIKVDTFWQRHGAQKR
#> 954                                  RIIQVHVR
#> 955              PGHTIVLGTTRVGKTRLAELFITQDIRR
#> 956                                 RKSFQPRRR
#> 957                               KTGRWAVRQMR
#> 958                                    RTLRNR
#> 959                       EIAQPAFDKTSDPTLLLSR
#> 960                          WWDPRVGLNYFRQIAR
#> 961                           TLEAILEQQTTTLAR
#> 962                         GALELIKVVLQSFTLGR
#> 963                      KVNVGLYHAEEDGLQLLNLR
#> 964                    LMNRIHVKVTEESIYLVAAIQK
#> 965                           RLWTGYTDILRTFFR
#> 966                        KEMRIAEKSRQAGVKYGR
#> 967                                RALFLDVQRR
#> 968                                   RVKEALR
#> 969                 LDNGRFALSMQALQIAQAHANEISR
#> 970                 MEIVEEVAMPSIRRMVAKIRAVLEK
#> 971           VESTKNAAGEYALDKFVDENWFWQGRYQYKR
#> 972                             KLETVNEVGALGR
#> 973                        EVDLGRAAVDTAILIDLR
#> 974                         RVMFRRAMKRAVQNAMR
#> 975                              RQAMARQQQRIR
#> 976                            MVRRRTLQTDQLAR
#> 977                                  REQHKARR
#> 978          DKTAYLWHIDRFALSFWVEILLLAIPLLLFRR
#> 979                             LYIQLEQYKVFGR
#> 980              RQGYRDALQRHNLPFHDDYLRGVDPTRR
#> 981                              RKSMIAYELNLR
#> 982                                QTKALHQLLR
#> 983                               RQAYQFRSFIR
#> 984                                 PRLPLNSFR
#> 985                          TQKQHTNTESLLARIR
#> 986                                INPRDIAYIR
#> 987             QKMSGSGETFRGRAALVMIDGIPQSNPLR
#> 988                                  RVSRMRLR
#> 989                  EQIQDILFLDIDNDSFLFHGLTLR
#> 990                                ARGFEFQSRR
#> 991              HKLELIEKQAPTLLNYMQNRVRTMQIQR
#> 992                            QSISAFDIAFLSNR
#> 993                        QAGLKVGYLYRWSSTYLR
#> 994                            KGFLRRKWQLLLIK
#> 995                         KWDEKIVSPVKSADVGR
#> 996         ARYIYALSQEVEATLAQIDGVMVARVHVVLPER
#> 997                            DLTLEQIYAELERR
#> 998                            DLTLEQIYAELERR
#> 999                            NDLIDPAGAAATAR
#> 1000                        KQRSESLEQQREAVDKR
#> 1001                          NDSLSQLIARELQAR
#> 1002                    VYDAEKPQPFTAISVPNSPER
#> 1003                              TQDMLKKQRVR
#> 1004                                RAARAETLR
#> 1005                                 RAFKLLPR
#> 1006                          ADIERYLAINFNQAR
#> 1007                 KERIRAKRIAVDVAGHSPQLDTLR
#> 1008                                   RWKTTR
#> 1009                                   KRLRRK
#> 1010                             REGLSEQFTALR
#> 1011                         LPLNATPFGITRGLEK
#> 1012                         PPQPSFALLGNWDQRR
#> 1013                   DNLQRAAFATLRAHGQALNLKK
#> 1014                         NAYYLLEPAYFYPHRR
#> 1015                           RAIMARFKALLEQR
#> 1016                      QLLMVLLDNIPEKPDAPKR
#> 1017                 ETLHAIRNAYKLLYRSGKTLDEVK
#> 1018                      TLNAGDRLWVRGGKYVFTK
#> 1019                              KKKKGNTVAGR
#> 1020                         PYTSRYIGSLVADFHR
#> 1021                               RQVDLFLARR
#> 1022                           EFLPHLRGSQANKR
#> 1023                                 VGADFLKR
#> 1024                    QEISEQKIIMEAESRRNNPPR
#> 1025                  AGFKDADIYADQKQVTIVADQTK
#> 1026                  GNLIALRELALRRMADRVDDQMR
#> 1027                                   LYRVRR
#> 1028                            LLMKMPWNGGAKR
#> 1029                        WDNAIMNTAVPINTARR
#> 1030                             ARTSLALDANVR
#> 1031                        QIRYQARAVDVNLLTQR
#> 1032                             QFRLAEVPALLR
#> 1033                            VIKYIWQLSVNYK
#> 1034                     QENAVDDLLGGLASSKNAPK
#> 1035                                WLFRPRLLR
#> 1036                       AGEWELPIDPIPAALNSR
#> 1037                                VGIAYKLAR
#> 1038                                 RNFVRALR
#> 1039                 REAAGETAEAARTPRPAQKRAPRR
#> 1040                    GTNNGGVANGIVNNGSEIKNR
#> 1041                             QNRSIAVDNFAR
#> 1042        TRAARLYDFSDVGEAESTLDQLQQRDDGPFVVR
#> 1043                                 KVFQSEIR
#> 1044                          YFSVTTRPETEALMR
#> 1045                   EGKAKALMARISAVNTQGKQMR
#> 1046                               RRSAFIIALR
#> 1047     FINGLKKASVEIDRKILADIAVFDKLAFSALVEKAK
#> 1048               QRALLDVLLHLESQLGDVSQMTVPSR
#> 1049           VEDILDYIVSYYRLDLSEAEVVRRASADAR
#> 1050                   ANEQKLQGLLLLDSNKMLLEQR
#> 1051                  EALAANLAHTDGQDVFKVRFAGR
#> 1052                              RLSKTLNRLRR
#> 1053                                 RWWQWLQR
#> 1054                                QERQMRQQR
#> 1055                       KAFITALDGLVARHESLR
#> 1056                     EKKPALADLPPNRSAEIIGR
#> 1057                    LLFKSTGFFYANIFIPYSRIK
#> 1058                   PARKQAPRPTRAAEATEGAAER
#> 1059        EVQELGDILNKLAPVAGSRVDAKVAIIFDWESR
#> 1060                            RNYKTNNLYLKLK
#> 1061                       KEGIEQYYEERREAVVKR
#> 1062                                  RVFSRIR
#> 1063                             PFNAGKQEEVKR
#> 1064                           YDAELLRSEFRPPR
#> 1065                                ARDFAIRRR
#> 1066                         YIRAAPDASFPDPIFR
#> 1067                      MNSMFWRLVFRALRLRMQR
#> 1068        AYGYTTQTYYRKQSLMPLRMKVDVWSDPNGKQK
#> 1069                                 RRNYIILR
#> 1070                                TNSLTGRWR
#> 1071                             RAEDILLQGVGR
#> 1072                   FVFAYTVTVRNLGRHEVQLLGR
#> 1073                            QLRMEFFYREMRR
#> 1074                              REAINLKGMIK
#> 1075                               REQLAALAER
#> 1076                   KYIIKASSESHKKFLENYIDKK
#> 1077                              QTFTRALLHPR
#> 1078                         QWLQLLEEDWRIGQKR
#> 1079                         RDQRAYGFYPIVATIR
#> 1080                                 QVLYVARR
#> 1081                                 RGEPLQNR
#> 1082                 VGKVWFITGASRGFGRIWTETALR
#> 1083        LQNQMEIQGNSFPHATLHVTIPHKSDEVMVKIR
#> 1084                                WRGIRPTVR
#> 1085             ISAEVEITRLDDSLKINQVTGVEVGQYR
#> 1086                    ENGSFMYRWTIRGGPQIAGTK
#> 1087                              RAHITVTRQGR
#> 1088               KRFNIYTKSVAVLLSESIAEMAKKWR
#> 1089                                VRFADLKRR
#> 1090                           QYLSPLVESLPADR
#> 1091                         DKLETLNLFALAASIR
#> 1092                       VGSNKSFQQEFVQGWGMR
#> 1093                                 RRYWLLSR
#> 1094                         IARLNQEVEARYDRLR
#> 1095                          SQYRRLSLWDAEARR
#> 1096                          DINRRMSIGEAKARR
#> 1097                         VFVLWSRPTLWRYVQR
#> 1098                        KGFAEGIASDPQIKIIR
#> 1099                                 RFANLADR
#> 1100                            REAELRTQTQPLR
#> 1101                                 RWREEVAR
#> 1102                     TGADMWGLFVLKSKSSHTIK
#> 1103                LDLPPFTLIGATTRAGSLTSPLRDR
#> 1104                             RQINRLLNWHWK
#> 1105                   GHEQSILRALTDMREELLAKFR
#> 1106     DHQWAWLQVESLRSQMNVVPGNVAHRALQDTQLTRR
#> 1107                               RVRMDEAFLR
#> 1108           ALAKNYISHQDYTLLPGQFKYLPPEALDEK
#> 1109                    IKKTTEFEQNSLEPNRHLDHR
#> 1110                                 MARRFMVR
#> 1111                               KTFQDKSSVR
#> 1112                  IFNGVKTIRPDNKLKFDKEWEAR
#> 1113                           QLLDNRYNVVDQLR
#> 1114                         TELLLLEFRTQEASLR
#> 1115                          RALNEKVGRLWTETK
#> 1116                                 RKAEETAR
#> 1117                    KSRGVRLVGLHVTLLDPQIER
#> 1118                      LRESGPPLAYRGILEPQRR
#> 1119             RTSTTQVANSTKPTLAENVAKMQDGINK
#> 1120                        GTLRRNIVEVAGIEIIK
#> 1121                   KLGLQPVPMHDIAMHLRKAEER
#> 1122                               QQFNDFILTR
#> 1123                               RWRLFPRSLR
#> 1124                              RLRTSRWLRTK
#> 1125                           QLRMSEIMKEAIIR
#> 1126           ATLALVNKLAPELEIDGEMHGDAALVEAIR
#> 1127                               GVKLYEIIAR
#> 1128                             RIRQKADKRGVR
#> 1129                         DEGKVLRYVGVIEEGR
#> 1130                          NDSLSQLIARELQAR
#> 1131                          TKLSSILKNIYFDER
#> 1132                    QYADVDTIEPYALLALEAAVR
#> 1133                                 RLQRILQR
#> 1134                             RVFRNNRSRKQK
#> 1135                   KQRINGVMLGYYDEVSILARVR
#> 1136                         RGHYQPHLRRMRAQYK
#> 1137                 KQYPMTLRGAEKLREELDHLKSVR
#> 1138                      LHIAINTFAHPNGYQRWQR
#> 1139                                 RAVFSIAR
#> 1140                                  RRERYLK
#> 1141                               QVTFQRRIKR
#> 1142                               RMLAMRHYKR
#> 1143                        EVEMVYRLDINEFRGKR
#> 1144                         RLSVEYRAKGNSWEGR
#> 1145                                  RFETKLR
#> 1146                        EETQVGLWGERGPFPAR
#> 1147                                  RLMRDTR
#> 1148                                 LILLYAFR
#> 1149                          RMVPFAEILQLNIER
#> 1150                          YFGARYLVQWIDNIR
#> 1151                          YFGARYLVQWIDNIR
#> 1152                          YFGARYLVQWIDNIR
#> 1153                      RIAHTSESQKTDNQPALNR
#> 1154                                RIEDLSLFR
#> 1155                             FVEKNEEPALFR
#> 1156                   KEGNKHAQWRESLSTLAQNALK
#> 1157                VTLQESQRQLVQLKQLAAEHEQKVR
#> 1158                       KNNPLTSPSIVKVAERSR
#> 1159                            QSLRAVSWAKLAR
#> 1160                          QEKAQFYLALRARRR
#> 1161                           RFYIKLIDNNAEQR
#> 1162                                 RLQRILQR
#> 1163                              SVRNSLFSFVR
#> 1164                    SAESARLYGEVGDALEVTAGK
#> 1165                               ASLTEGSDLR
#> 1166             IQTMENQADRFITKEQKDLIVDSYLKWR
#> 1167                  EVNSLADRFNKEHTDVKIVPVYK
#> 1168                ADLISDLRESPTDDLLTGLGPVYIK
#> 1169                         SWLQKRENSDRTLRGR
#> 1170                            AFGKRIGYPVIIK
#> 1171                                  RLKFAFR
#> 1172                  KVDVTGTSKGKGFAGTVKRWNFR
#> 1173                      DVQEGLRVGADYREAVIDK
#> 1174                           IKVDLPADLERRMR
#> 1175                 PETGSIELESPFILLADKKISNIR
#> 1176                              RQVDLFLARRR
#> 1177                          PFSDERQKPIGPLSR
#> 1178                      ERLLAGAMIPAVWYVQAQR
#> 1179                      EAVGDHQRVKQEHEAALQK
#> 1180                                 NVYPAIYR
#> 1181                          PEFFSSPRSPDPLRR
#> 1182                            RSIMGLGYILKLR
#> 1183                                  GWVRTRR
#> 1184                   KSVYGLPTFIPNDDWIDIKYLR
#> 1185                         LPALLPDDFIPDVNTR
#> 1186                         HFDAVLSGIYRSTYPR
#> 1187                              ADRIMENILAR
#> 1188                EVTVNASLDGGAIREALKLNTIISR
#> 1189                           ALTDVEQPLVTVRR
#> 1190                                 RAFIVTDR
#> 1191                                NVRYSGWQK
#> 1192                                RFWNQIKSR
#> 1193                              KQKVIQVKEIK
#> 1194                          LLNATQWQNRPYWQR
#> 1195                   ARREKLVTLRENGIAFPNDFRR
#> 1196                            ELFRISQQKDSTR
#> 1197                               RTFRVEGPKK
#> 1198                        DVKLVKFDNYWQKGWPK
#> 1199                             RNRHAHVNRVTR
#> 1200                            FNLIEISNLAARR
#> 1201                 AHEFRYRLSGADQLILRGQQRTLR
#> 1202                         RETAVSQQALMALLQR
#> 1203                           KVSAANVQLDDKQR
#> 1204                      KSRTIKRLDYRYQAHLDTK
#> 1205                          FLNELAGEDEPEAKR
#> 1206                                 DRPEKLRR
#> 1207                          RWRKNWFSAPIRQER
#> 1208                                 MASIQLDK
#> 1209                              QKYGLVIINSR
#> 1210                           VEQPDKMFRRTIRR
#> 1211             PGHTIVLGTTRVGKTRLAELFITQDIRR
#> 1212                RGDDWIALNADQALQGAADVLRQAK
#> 1213    VFALSVNQAGFIVTAAQLGYAVGLLFLVPLGDMFERR
#> 1214                    QRFGKHRTIAPLTDRLHPLSR
#> 1215                     GAAARELWYRAKQEDWPLRK
#> 1216                         RVTDVVQAGQQVWVRK
#> 1217            TVRNAKKAGATVQVARYGDNALDKVQTVR
#> 1218            TELQRRFDELLRQLTALNLDINRDTVQLR
#> 1219                     RYGITRLLEVLPEPPTKEAR
#> 1220                      RRTFRDLIRDYRLTGRARR
#> 1221                                 RLVANHYR
#> 1222                                RAKQMDRYR
#> 1223                     EPQRIRVVDLMAMVKEKAER
#> 1224                  KYVDLTRGESNVVYLVNGKGEQR
#> 1225                             RGGTIMFSNNKR
#> 1226                          YSLRDTINQVYKSAK
#> 1227                             DLEQVIAQLDIR
#> 1228                       GAPVWKQLFALTELEAAR
#> 1229                                  KKFLIEK
#> 1230                     ALHQINLSDALLRLLDWSLR
#> 1231                        DRTKKPDSREAKPSRRR
#> 1232                                RLEERARKR
#> 1233                           RSAVKIKTFVDAVR
#> 1234                           QEAERKRIEAEQHR
#> 1235                               SAAMREQSKR
#> 1236                                 QSLSKKRR
#> 1237                                  ERIKAMR
#> 1238                            WQQQVQNIERQLR
#> 1239                          AQLNEELQTVLKANR
#> 1240                                   RRRPKR
#> 1241                                   RRRPKR
#> 1242                          RALIALDHQDEEEQR
#> 1243          VAAGEKELYNSRRQQLHNEISGLEEQLIQRR
#> 1244                                KVFELDDRR
#> 1245                                  RTFRIIR
#> 1246                            RLVVFVLKFELFR
#> 1247                                  RFRTALR
#> 1248                               YLPFAISDQR
#> 1249                   SSINVNVEVWVKKVSSEPIGQR
#> 1250                            RSLYDLRKRYGVK
#> 1251                           RTGFGKTWIYALIK
#> 1252                 LQVGLFRFDGEANQQNMNLKILTK
#> 1253                       VEIDLHTDGYVLVIGNLR
#> 1254                               QWKERLKLMR
#> 1255                        AETELEKIWSKYLERVR
#> 1256                               NQMFKIEILK
#> 1257                              DLIANFIEDKR
#> 1258                         DQVRVRLLKHDFPNNR
#> 1259                     KEHRVVSHNSDTPVLSWLPR
#> 1260                SKAVVLDSDVIELQRVMELMNKQFR
#> 1261                       VDHALDSIVKNLTITGVR
#> 1262                          PRYQSRALSLDADIR
#> 1263                  ILQQSTLQKRLMQAYMDPTVGLR
#> 1264                                 TKAPLYRR
#> 1265                           LDELNQIRHSLRKK
#> 1266                         QTLFLALSDERLRYKR
#> 1267                               RAWRVARFIK
#> 1268                   KYIIKASSESHKKFLENYIDKK
#> 1269             EILSKDLETSSGMLTLEVQKDLKAALDR
#> 1270                           QEKAQFYLALRARR
#> 1271                         LKNNPSYINEVEPIRK
#> 1272                    AKQPGLDFQSAKGGVGELKRR
#> 1273                LQLTITNNGNKLFGSSVPIRAVHYR
#> 1274                      KSRTIKRLDYRYQAHLDTK
#> 1275                         LGFKDVLIRPKRSTLK
#> 1276                      MNSMFWRLVFRALRLRMQR
#> 1277                       LVHRQSEVRKSGSLPWLR
#> 1278              IGGEEFIILLKDVPYQTAVMAIERIRK
#> 1279                                 FITRFIIK
#> 1280                           QTLDSVGLGAWRDR
#> 1281                      RANRLAHHLLTLGVQPDDR
#> 1282                             RLLVRGRGALEK
#> 1283                     QPVTLRIDVLDNLFRMNNIR
#> 1284                     DNSQYRGREFVEKMKELIPR
#> 1285                               RVYILPLDAR
#> 1286                        TRRKPKYPLYLDELETK
#> 1287                                   RTLFRR
#> 1288                TQNIHQHRILILDFGSQYTQLVARR
#> 1289            RVTMESVGLLQAADKLHLKDTKKLAQALR
#> 1290                         VTKQYQEMVSDMSRGR
#> 1291                           SIYQNSLIESELVR
#> 1292                                 RVKIDDER
#> 1293                                  ELRSLFR
#> 1294                                TRKYVKRPK
#> 1295                                  RTRVWGR
#> 1296                        DILFHTPIAERWRAAAR
#> 1297   ADDLNTKETLTNNRAQALRAEAQDLDALRGVGQESRLR
#> 1298                           YEHHRLVRRLEAVR
#> 1299                               LYRVRRDIQR
#> 1300                                 SSLLTRLR
#> 1301                       LDSKNLDIIGGVEFVIIR
#> 1302                                RWMLIQRRR
#> 1303                   QELLMKNSDLLLLGQLKQENAR
#> 1304                        FLAKQFRVAKSLVVIEK
#> 1305                     IKTKVGEGFLTGDPLVVAAR
#> 1306                              TQDMLKKQRVR
#> 1307                    AMATRYIASLEKSFGVRLLHR
#> 1308                          FFVVILIINQEAGGR
#> 1309                    LVAYLLAQPDTVLEPADLRQR
#> 1310                               YLRPFSNLAR
#> 1311                    TENAVRLLSSVVYPDNDPHLR
#> 1312                            DIRPDVLKDVKNR
#> 1313                  EGLAIMTGLFWELGEQGSHLLAR
#> 1314                           TTLLTETLRRLRGR
#> 1315              GRSTYMEVMLDRYLNPRETVSVPLSIR
#> 1316                                RLLFQGVQR
#> 1317                          RMGIPLRRLSETINR
#> 1318                               RMRQQRLRAR
#> 1319                  RVRFLRQVQHELQLENITPVQSR
#> 1320                      GIAPIIDHILERDAALANR
#> 1321                        HLRTIQEEPAMDVFQSR
#> 1322                    DEEELADINELSMFTFFKLFR
#> 1323                       HIKKISNLVDDEFYFSRR
#> 1324            RWLTEELEWDVPEGDFWNDPKLASRLAGR
#> 1325                        RYLAEFLSDRRVVDTPR
#> 1326                          ERLMERQFIDELERR
#> 1327                                  RFMKLMR
#> 1328                          MRALDRPRATRLALR
#> 1329                             LMGATLVGILER
#> 1330                  QLKAYRVSADPTISFVLRDIGPK
#> 1331                         WNEYLVRKALTTLMAR
#> 1332                              DNIVQRAEIRR
#> 1333         VEFFEGNFTEYEEYKKRTLGAEALEPHRIKYK
#> 1334                         KDYHYVHGHPDVLLFR
#> 1335                            RSLLNSDALDGLR
#> 1336            TVRNAKKAGATVQVARYGDNALDKVQTVR
#> 1337                       LILDVAHNPHAAAYLANR
#> 1338                         KMIMAMVQDIRVILIK
#> 1339                          EQLPELILMAKKVER
#> 1340                          AKASAVKRHAKKLAR
#> 1341                                 RFWIEEPR
#> 1342                                RRFLRDAVR
#> 1343                             VRLAAGLDKQNR
#> 1344                     LIERPHVETSNIGGLAIVEK
#> 1345                       ILYGFPEVVRRLAAITGK
#> 1346                            RHSHGGERTLHYR
#> 1347               DQQSQLKAISASLSTLEKNLTSLTNR
#> 1348                            QRQYRRENKAARR
#> 1349                          SKFRMWRATLQPDRR
#> 1350                        IVRLIKVSLEVVGAPER
#> 1351       QNITADTPLGKHDIEGNSVFVLISNDSTDLLEKR
#> 1352                             EHQPLWHIVWER
#> 1353                               RLLPRHISLR
#> 1354                                   MLRLIR
#> 1355                    EKPTMFASVPKELDTVFRVDR
#> 1356                              EQTDETRPLFR
#> 1357                    EHWVRVVIEGKEGKEGKPTFK
#> 1358                             RTRANTKTRQGR
#> 1359                             TGIMRVYGTQLR
#> 1360                           QLGIPFARAKVGDR
#> 1361                          GTLSSVMVVPMPRLR
#> 1362                     TGADMWGLFVLKSKSSHTIK
#> 1363            EGRLVVSHDETPDVSFSADANDLILIAAR
#> 1364           ESENKIEETRSRYRSEALSQLSEAQTNLNK
#> 1365      NLREVMDQVELSITLLDKVAGQLSGGQAQRVALAR
#> 1366                                  RSLRRMR
#> 1367                           QLRKARDDRGLELR
#> 1368                  QLKAYRVSADPTISFVLRDIGPK
#> 1369                        AGHLPTLSLVASSRNSR
#> 1370                       LAALPSRLEHAADSTFRR
#> 1371                    MIARAQRVAQFIRIPASLQAR
#> 1372                                 RRFLEEVR
#> 1373                          EKQDERRKVMIFPLR
#> 1374                              RSTGQFRELAR
#> 1375                        GKPFAPLVEKNSKSGGR
#> 1376                               QLLAEELVVK
#> 1377                                 PMKEESIR
#> 1378                    SLPIMVHKQYAPRAALQQYWR
#> 1379          LGDMRDSLWPKRFPLLGQAADPQESEQVTAR
#> 1380                             DISEHDAVEYAR
#> 1381                                RTRYQAEVR
#> 1382                                RTRYQAEVR
#> 1383                                RTRYQAEVR
#> 1384                    QRLNNLRSRLDQQLLDLRDHR
#> 1385                    SRATRVYDEQAVELFASRTFR
#> 1386                                  RSQSKGR
#> 1387                          MVNLLELPKVEAISR
#> 1388                                RKNMLVGQR
#> 1389                     LRGSYHYAVYKLLRLQRFIR
#> 1390           NPYQGETISHDPDELLAQYQTQQAEISELR
#> 1391                                 KKQIDNFR
#> 1392                           RRIDEWQTLLVNSR
#> 1393                             KVEVLRKAMLAR
#> 1394                          RNDWTLSQFRQINNR
#> 1395                              RRRGQLNSRHR
#> 1396                                 RHLRRYPR
#> 1397                            RKPMKSLANGIKR
#> 1398                        QTFDGQGIAQAMSVLRR
#> 1399                   KTPMNLVQRFKPMKDVLDRFGK
#> 1400                              RRSGRYTIRLR
#> 1401                              REGGLIPRKPK
#> 1402                                 KKSYIINK
#> 1403                         TTSEKHIVYNPHKFIR
#> 1404                  WWRSDKRKQHDWFSKKVPLRRLR
#> 1405             QDYYESLGVAKSADDREIKKAYKRLAMK
#> 1406         AAEVPNMGDAVLQGVGGLLAEQTQNVKLAVQR
#> 1407             EYEWGTLEEAVVRAHAPIDAIAGGAKIR
#> 1408                               RKSVPMLRSR
#> 1409                                  HLDPKRR
#> 1410                              QMVLLRHSLLR
#> 1411              YSLPYREKVVDHLSEDDSFVTSKGILR
#> 1412                      MNSMFWRLVFRALRLRMQR
#> 1413        LMITLLDHLPPSQTQTLVTGAPGPQTQRRLSGK
#> 1414                       EERFHRFMQLQQAISTQR
#> 1415                 VNTTALLQNRADFVSITRIIASHR
#> 1416                       TFKHEFSVPQQSVDQIER
#> 1417                               LLNEKVRGLR
#> 1418                            QLQQLARKASDKR
#> 1419                            QKGLETLTLIKER
#> 1420                                 RYALRLHR
#> 1421                         DKSYLFLKKNDILIQR
#> 1422                        VSPKATNEALSAPVILR
#> 1423                 QEQKDDPRLLQEPLKWSARRYGLR
#> 1424                         QKMAQQVAPWDAQEFR
#> 1425                    QQGFQKLFHQVYAQAYDRAVR
#> 1426                         KGFTKVLYRRMNSIWK
#> 1427                           EIRDAKIVYANRLR
#> 1428                                  RWKQTTR
#> 1429                          ASRTIIWNRGDVVHR
#> 1430                           RAMDSAFVRLPDVK
#> 1431                           QSVLFSDRDNILAR
#> 1432               HTSAALTINENADPTVRQDFESFFNR
#> 1433          NNTKGVLQNEYRVPVDPYGETDVVIFADNIR
#> 1434                                 KRLKDWIK
#> 1435                                 RFFWPFRR
#> 1436                          ALWDTHQHEFGYYRR
#> 1437           EFEKYTFSDPAVQNHLSRITLLQADVTANR
#> 1438                               RARGTLRYDR
#> 1439                         LVKGWLLQLPAHYHQR
#> 1440                                  RIFLRKR
#> 1441                         KTLDMGPLISAAALQR
#> 1442                       ELRKTTRVIGVYDWMFLR
#> 1443                            MQGFIIFDDYGHR
#> 1444                                 IWDKLRKK
#> 1445                                 VQAFVINR
#> 1446                      SARGALLQQHIIMGAEITK
#> 1447                            MSHQGIQVPWRYR
#> 1448                    REKYPKIDDVIRVNLDLKNLR
#> 1449                           SLEQAVISLQMSLR
#> 1450                               FKKTQQQDSR
#> 1451                                  ELRLLQR
#> 1452                            QVIRDLSVPQLPR
#> 1453                  QLKAYRVSADPTISFVLRDIGPK
#> 1454                             LDKLAEIVKPQR
#> 1455                               YDIKVIGVNR
#> 1456                        QGSAVIESLAALYRQEK
#> 1457                          MAGRNRTEFYKLLGR
#> 1458                                 ASLLAALR
#> 1459                                KGRKLMLLR
#> 1460                              ILENIKKVTRK
#> 1461                      KRLRRKLDDYQRNVPPHAR
#> 1462                                YIVRDDVTR
#> 1463                EIFPRLTVEENLLMGLSRFPGKQAR
#> 1464                       SASAAREIKDLIGISVGK
#> 1465   TTENELLYHEAKKVSTLVPTKGTEDKYVGIGLNIKDAR
#> 1466                                WKAADLFLR
#> 1467                                  RITEAHR
#> 1468                           RSLSGRRYLNRRIR
#> 1469                               RNILRMLVDR
#> 1470                               IDEFISWVKR
#> 1471                        RIDMNLLLTLHALLTEK
#> 1472             QQIKQAKMLAPLADPIDDLPSHRDKEAR
#> 1473                        KSVTISADTFEPYGAPR
#> 1474                          YRKIDELPFDFIRRR
#> 1475                               IPRYGVRTFR
#> 1476                               IPRYGVRTFR
#> 1477                               IPRYGVRTFR
#> 1478                           VVAEIFGKNPSALR
#> 1479                              ETLRRYQAQER
#> 1480                                 FAFKILSR
#> 1481                                DIIAYQIQR
#> 1482                          EMDWSQAYTQTLEPR
#> 1483                               LLENRVLLKR
#> 1484                                 RKQLWRAR
#> 1485                                EGEIPIYAR
#> 1486                    IEDEFKAKLFLDNIHRASVIR
#> 1487                    QRLNNLRSRLDQQLLDLRDHR
#> 1488                        RATPKREAPHTKEHVQK
#> 1489                              RHGNIVRDIRR
#> 1490      QAEEEAKEKAAEAAKQKAAETAKAEAAKAAAEAAK
#> 1491                      QTSRQIAKGGAEVDEGVGR
#> 1492                                RFGGMKIER
#> 1493                            IPRFVNLPAEAPR
#> 1494                         GVAASYLNDSSNLSLR
#> 1495                               RWISAPATEK
#> 1496                                 RAKQLTRR
#> 1497                QPHAPIAGTVATLGMTEIMGLAAKR
#> 1498                QPHAPIAGTVATLGMTEIMGLAAKR
#> 1499         IRNTYMGGLAGTDLAVKVGNVAGGDAAKATVK
#> 1500                               QIAAFAAAVR
#> 1501                        RTRFSSNNLTYIHSITR
#> 1502              RIKLIISAQASMFDIYQGEHLKFEYQR
#> 1503                          AAFLMSTAETHHNLR
#> 1504                     TGADMWGLFVLKSKSSHTIK
#> 1505                               KHREGEEITR
#> 1506                       AIGVMGDVAYEVVDVGLR
#> 1507                      SARGALLQQHIIMGAEITK
#> 1508                   EPLKRRLNSIHMDIARDFPTLR
#> 1509                             SLKLLIDRTDFR
#> 1510                         SDRVFLQSFDVAELKR
#> 1511                       RSSFLDRRLELAGDLHIR
#> 1512                            RAVKDEYAPGIGR
#> 1513                         RRILINEEQGLDGNLR
#> 1514                                 RAELLRLR
#> 1515                   EGFREQILDSGLNSTMIVVTNR
#> 1516                         LSNVYWSADRSGKGSR
#> 1517                            RTRTRAAKVTKQK
#> 1518                        IPSDWGLEIGVLSEIHR
#> 1519                         YPPLGLMGAVMPILPR
#> 1520                 YVLLPNAYRVIVPPLTSEMLNLVK
#> 1521            EHPAPEDNPIIGRSFITWDKSFSHLPSAR
#> 1522            QTMERQDIMPNVDAETSPLIFLSVSTNLR
#> 1523                                IFKDESKLR
#> 1524                                 KGKGLLAR
#> 1525                          QMFGLEPLEIRMLVR
#> 1526                                   RKPRIR
#> 1527 LTKHTTSTVVHAQPLPNPYEGAAVLGAVHAMDVWFIAGVK
#> 1528              EHTDVKIVPVYKGNYEQNLAAGIAAYR
#> 1529                         ATTTITIDLGRVRDVK
#> 1530                                 QNDLLVIK
#> 1531                              GTVIEYIEVER
#> 1532                              GTVIEYIEVER
#> 1533                              GTVIEYIEVER
#> 1534                        YPQLKRFISQVLAQDPR
#> 1535                  LIYGLGAEGEIHAGQLQLTAIDR
#> 1536                           VLLMRQATIIKSNR
#> 1537                            VRRIYGVLERQFR
#> 1538                          ISSEQHQKLRVGLTR
#> 1539      AREEDIPIVMGTATPALETLYNVQVGKYRRLNLTK
#> 1540                   VENSTKVREGLETAPVGEAILR
#> 1541                               QSKEMQKKVR
#> 1542                     LTNEADVQTMDLIRDVLDAR
#> 1543                                 RDTVYELR
#> 1544                                  RHPMRLR
#> 1545                           KTKEEAAKKATTRR
#> 1546                            NTAVPINWVTALR
#> 1547                   SDLHQIVIHYGFVFQQVSIPVR
#> 1548  LDLYVVDGLPTSVTRGARWEHWFAQSVKDRPGLEMYKNK
#> 1549                            RQRIRQKLEKLAK
#> 1550                           RDGQVLDLRGARQR
#> 1551                              KEYVNDVLQQR
#> 1552                             KTLQESSELTQK
#> 1553                             NQRIIPTVASKR
#> 1554                           QAQFIRANTRLGLR
#> 1555                           QAQFIRANTRLGLR
#> 1556                           QAQFIRANTRLGLR
#> 1557                           QAQFIRANTRLGLR
#> 1558                           QAQFLRANTRLGLR
#> 1559             EILSKDLETSSGMLTLEVQKDLKAALDR
#> 1560                          FDEEDVLQNFIEEAR
#> 1561                  KETVLAQYYAVDAEAQAVAQHYR
#> 1562            SGRLFVIQSDGNQHIALHSSGRSAMLSGK
#> 1563                                   RWFWLR
#> 1564         EEQNALLKKLQVLGLPTIVFFDTQGKEIPGSR
#> 1565                          RSSVWVLSRDKIGLR
#> 1566                           TGAEWTRAKEPEVK
#> 1567                          AAAFELMHESAGIVR
#> 1568                         EATTKPRIPQPKVVPK
#> 1569                            KVTGSATAMFIHR
#> 1570              EHWTSKLLPAVGPILLFLFWQLAVSAK
#> 1571                           REIAFPLRFALLLK
#> 1572                             RRYIRTAGVTRR
#> 1573                            ENDIVIWRLAFRR
#> 1574                         KGKAPKRKPERKQAIR
#> 1575                       ETKMQQQDNLLAMNRIAR
#> 1576                            VRSVYEGSRTDVR
#> 1577               EIAQRTGYSISTVSRVLSGQSNTSER
#> 1578                                   RFKRWR
#> 1579                                 ASKGTRER
#> 1580               PFELLLDHLGEYQNPYTGEQYVLESR
#> 1581                             KELISKWVNEVK
#> 1582                    DLTDSAIKMVRHQSIEKNRFR
#> 1583                               QRLFFRKSRR
#> 1584                              IRSNVMAAIRR
#> 1585                              HDFAKLRIRIR
#> 1586                         VLASTRNWLRYKLPKR
#> 1587                VTLQESQRQLVQLKQLAAEHEQKVR
#> 1588                           TIFRDAQNEMTQIR
#> 1589                     ELRGAVKEKEGFMQMVRGLR
#> 1590                         EGAAFIDRHIIPVAQR
#> 1591                      KTLKDFTGDQSQIELDKLR
#> 1592                     GRMIQFNTAAPYKNAAGRLR
#> 1593             EILSKDLETSSGMLTLEVQKDLKAALDR
#> 1594                           LSRIFLKRRVSIAR
#> 1595                  EGRTRLDALVTEIGKKDIVRMGK
#> 1596                               RAFLSMLNVR
#> 1597                                 RIRWKIFR
#> 1598                       KTLMTPVIGLSKRFQDFR
#> 1599            RVTMESVGLLQAADKLHLKDTKKLAQALR
#> 1600                 GRSGVDQYETEQVLHAELLERVIK
#> 1601                      LARIMGKLDKRDLMSKNSR
#> 1602                  VFGAPTALTSEHLTLRTDNLEAR
#> 1603                             KTAKERSEILYR
#> 1604                   EVGDRTFVQVDIITGSVGNPVR
#> 1605                              RYLNKVNSAQK
#> 1606                                KHEVLRKAK
#> 1607                             LSGLWLPQDDSR
#> 1608                            RRISALGPGGLTR
#> 1609                      KYNIHYKKMNGSRKYRFNR
#> 1610                                 FITRFIIK
#> 1611                                QELARRLRR
#> 1612                               KLPLTQLRNK
#> 1613                              NDIKQFRQTLR
#> 1614                                TRLYRLKQR
#> 1615                                 RLLHTMLR
#> 1616                      VSWGDSIIHHQTIMLVHTR
#> 1617                        RLWDHVLFLASVNRAER
#> 1618                            KAAVKRALRDLLK
#> 1619                                RALFLDVQR
#> 1620                   WLKIGAGIAYIPLMWIVDEINR
#> 1621                     GARRLKWHLYEHIAQVADDK
#> 1622                           NEKKWEEAKIRRAK
#> 1623                               EQLSRGKRIR
#> 1624                          RTKNINQETFRKEWR
#> 1625                 LTRNASVGGAMVLRKFGTDDLARR
#> 1626                                IDDFVKPYR
#> 1627                                MPEGPEIRR
#> 1628                                  RFRTALR
#> 1629                      LIDHRDIVRQLADLFADLR
#> 1630                                 VMLRQEKR
#> 1631                   KRPDYRTLQALDAVIRERGFER
#> 1632                       ASRFRSIMEIKVPWNAFR
#> 1633                                  RRATQKR
#> 1634                                  RRATQKR
#> 1635                            VSMKVARDELRIR
#> 1636                         QQDGRSEDVSLPVLGR
#> 1637                             DWWQGIEQWRGR
#> 1638                  RLLASIYGDSIKDLQEAIPSLRR
#> 1639                                  RWKLVDR
#> 1640                         RKGNTLYELKEKDVLR
#> 1641                    GEQAKPALPTSPPTAFAIGGR
#> 1642                    IESSGAVRVLWDGVQYAVGTR
#> 1643                            EVFNIQERRMIKR
#> 1644                   NDKLQQYTPGLLSQATVNAALR
#> 1645                            TLFTIAQQIDRTR
#> 1646                   LTRDSNERKQLWSRRVSPRRIR
#> 1647                              HLILIDTGNGK
#> 1648                       QQRDKEKTQLLRRIQQQR
#> 1649                             EKEKEKVKVKVR
#> 1650                                 RLYRLRER
#> 1651                                 LRQAMEPR
#> 1652                                RTTTKLTTK
#> 1653                         AFRWRTLRRESLTILR
#> 1654                        AKSGVLMKSVTIAIRNR
#> 1655                    DGSGLIAETTILESLFINIDK
#> 1656                               RLPWDEQKAR
#> 1657                        EKQKVRRIYGVLERQFR
#> 1658                          TAQVIGNFNTLIMLR
#> 1659                             LELSFEEEQAAR
#> 1660                    RRLTAESMALLRGASQATWHR
#> 1661                         NLLRVARQRHQDVSLR
#> 1662                     SAPVLPLAEIHAAITEAAER
#> 1663                     FLIRRNSLAMSRAADVYSRR
#> 1664                       EIFDEKLFNILTSLRLMR
#> 1665                                 RERKNARR
#> 1666                            QELQRRQNALEVR
#> 1667                            AMLARFVERIINR
#> 1668                  ENSQLWSKFEKGGITKDLLKVER
#> 1669                    HVHKFIRTAIDMDKNRVFAQR
#> 1670                               YLSQRVIDDK
#> 1671                               FIPLAKKILR
#> 1672                             VARNLKLLAIAR
#> 1673                     IGEQGNNLSTGQKQLLAIAR
#> 1674                          LKVEEEARRIAEEAR
#> 1675                       TKNLAVLLSWRLGERRVR
#> 1676                      WFEIFVVSLMRVIPLTSRR
#> 1677           LRSPTYGSYAASKAAQELFANILAKELEGR
#> 1678                       QVDAGLAKVPSIYLVRTK
#> 1679                                  RLFDKHR
#> 1680                        QQGLSWFLKQVLRLLSR
#> 1681                        GTLRRNIVEVAGIEIIK
#> 1682                           EKVDARIAAANEAR
#> 1683                     KHPLFKEFSAPFRAFMMNLK
#> 1684                          EAHMDLFARSEPKIR
#> 1685                         EQNYAGLYTVGRGSER
#> 1686 KELDIVLIGDESLNMNKIRSYPIFINAYFFGTSKFLLKPR
#> 1687   QPTGRYQYVLNLNQPDAFAYLLERLSWLLGEHPVDYVK
#> 1688                              RVLLPDNFIQR
#> 1689                      AQENDEYMALIARALNAIR
#> 1690            LTELNRTNADPRDPRLYIMIKGGTAGWER
#> 1691                             RASQLLDISLTK
#> 1692                    REKVAQARKMNALTMPHPDRR
#> 1693                        KRQDARLNAAYKALLSK
#> 1694                         QWLQLLEEDWRIGQKR
#> 1695                     QQQNTAITENLRKVDNSTLR
#> 1696                            PMLLILREDYQRK
#> 1697                  QSGVKMPLVLVGDADHPTAYSMR
#> 1698                          MAGRNRTEFYKLLGR
#> 1699       FTERRHILHVEAAINSLYLAEEVATNGGGVVAVK
#> 1700                          TQIDRINRRVVLAQR
#> 1701                 PVMIGEIEENGQFNVVWQTDKPVR
#> 1702                        IKSVRSQVALYELIREK
#> 1703                         RSLLTGGLQRADNALR
#> 1704                                RALYWLAGK
#> 1705          EKNGMLNPVVLSALVGLIVIVVMIELLTFGR
#> 1706              ASSNLIKQLQERGLIAQVTDEEALAER
#> 1707                              REPRAERQRRR
#> 1708                         ADNLHMGRLYRFGVIR
#> 1709                         LDPTDSQALIAIRKAR
#> 1710                              KSIPPSVSHRR
#> 1711                     FSIPVRGTEEAATKLRDLSR
#> 1712                            RARQQQTAQQAIR
#> 1713                   VENSTKVREGLETAPVGEAILR
#> 1714             EAQPAPQTLGPLAWLMGSVLVGATLLSR
#> 1715                              KTAKISQVINR
#> 1716                               RHDEISDVAR
#> 1717                               RQNFAETTIR
#> 1718                    NFIAQTLSVPNSAHEAYFRDK
#> 1719                       ELRKTTRVIGVYDWMFLR
#> 1720                   QFRQKIQLVYQNPFGSLDPSQR
#> 1721                VSTLVPTKGTEDKYVGIGLNIKDAR
#> 1722                          QYAAQGKSLILVARR
#> 1723                                RIDNQLRGR
#> 1724                             RWRNRLAISVAR
#> 1725                                  EDVGARR
#> 1726                             FRQQLQRLQDIR
#> 1727                      EMQRLTQTLMKQSIGAVKK
#> 1728                               PQKKFFLTRR
#> 1729                              RLESFRYTRER
#> 1730                        KLDNKGKDINSAENIRR
#> 1731                            RKHANLRHILTKK
#> 1732                       KIKAEKYLVHQRVVPDFK
#> 1733                                 RFFQYLYR
#> 1734                  TAGRYGERVVSHDATFRVLLRLR
#> 1735                               RFWERLFVGR
#> 1736             MPHRSVQTFLLKSVNHRKFIGISLNLLK
#> 1737                     IALPKTPDLPVFDIYPKLWR
#> 1738                            EFLISPSVFSLER
#> 1739                  IRETPIVVQGRTLKLSDVATVER
#> 1740                          VGSTMLSQQVSVVLR
#> 1741                        GALWYLARKNAGRYKAR
#> 1742                        AKHLIKLYNDAGISNER
#> 1743                                   RLTWLK
#> 1744                 ETAEKAKRAADEQAKREAAEKAKR
#> 1745                    EELHDWLKAVITAQVSLDAWR
#> 1746                                   RFILTR
#> 1747                        HSGWYPDKVIRLYANQR
#> 1748                      VKELTGNEILRKFDDIALR
#> 1749           ISLSLTEIWVWVHTVYRGYLRSKPVSDDYR
#> 1750                         SKKLAPLAPIAPATGK
#> 1751                             MLVLKQQLKQAR
#> 1752                             LVEAVVGKTLTR
#> 1753              AGEQGRGFAVVAGEVRSLAQRSASAAR
#> 1754              AGEQGRGFAVVAGEVRSLAQRSASAAR
#> 1755                        QLTEIGDIRYDLVGLRR
#> 1756                               RYRLVKMGQR
#> 1757                           LFDEPGDRFLTAIR
#> 1758                               DIFILRSAVK
#> 1759                      QTHQLIINSKQYQANIELR
#> 1760                    QWGKESQSRAQELAGFRENLR
#> 1761                          QQERDDLTGPFNRAR
#> 1762                              RRAWVDRLTHR
#> 1763                                  ERMQGRR
#> 1764                 QEVMVNGRSRHVLGYLQDFLFHPK
#> 1765                      YYIFHPKANIHASIMQFSR
#> 1766                              LDKDVSLAVTR
#> 1767  EAYDRSVDVHISNIRQKLGALAGNMMTIETVRSVGYRIR
#> 1768                          IQYLNEKVIASAVIR
#> 1769                           HLALSYLQYQLDYR
#> 1770       ADVGLNQKWISVAAIAMKKHLDSSNYLLNFTLPK
#> 1771                             RYPTGRQASLER
#> 1772                             FVIRKMKRISRK
#> 1773                             KQDIFQPLPGWR
#> 1774                            KVLAVAVYNHYKR
#> 1775                       KDQKRREAELRTQTQPLR
#> 1776                                 FITRFIIK
#> 1777                               REEVRKKEEK
#> 1778                            RWSTLNKLRQSYR
#> 1779                      EYRRLYLHQGIDKGQTQLR
#> 1780                         RQFRQLWIARINAAAR
#> 1781                                AFRWRTLRR
#> 1782                              HHKTLEFGLVR
#> 1783                     FKAPLHNWSFLKKYQALLNK
#> 1784                                TFAISYLKR
#> 1785                        FKRTTLFKEYLLDVWKK
#> 1786                    LTKLVSIWGHGGYVPWGNLWR
#> 1787                          FARQFRMSLFNLLRR
#> 1788                    TEREIKGKTIRFLTSMTDPMR
#> 1789                                  RYLQKIR
#> 1790                    ESHDILVPTYLQRDYKVLLPK
#> 1791                  KFLGNQHPKVQKRSHMPARNMAR
#> 1792                                  RTLQKAR
#> 1793                        MVIELRDQYQTRLVALR
#> 1794                                RMLYLAYNR
#> 1795                      TQYQDRLEIVMRTYFEKPR
#> 1796                                NIREILDRR
#> 1797                           KVGDFFNKSRPSNR
#> 1798                          KVYQNNEHVHVVGLR
#> 1799                          NQNDFIEIQWVQSRR
#> 1800                               RSFLDRRKSR
#> 1801           HRSDTYAKLQSLINDESVPSFTSVPLPAHR
#> 1802                          QPLRWQPPMETHDRR
#> 1803                                 RQIIYTKK
#> 1804                                 LFDRTTRR
#> 1805                                  RLHDLTR
#> 1806                             ALQTSYIFKERR
#> 1807                        PAVTHYRIMEHFRAHTR
#> 1808                          TDPLESLRTMQAIRR
#> 1809                 GKNRTDFVLEAARAAAEEALIDQR
#> 1810                            VEAGARQLLDIKR
#> 1811                           LMQFKAWGLPVSDR
#> 1812                                RTLSRLSPR
#> 1813                      LRESGPPLAYRGILEPQRR
#> 1814                     EVVAVTGDDGHIDLVAFHLK
#> 1815                              QLVENYMIRHK
#> 1816                              VRWLRYSAHSR
#> 1817                             DRAKRLEFITRR
#> 1818                  GNIRAERVQDQNVETLFTSYDVR
#> 1819                       NDVSHYLNNDARLFLAVR
#> 1820                               LLKYKIGSNR
#> 1821                                  MKPFVRR
#> 1822                               LARFNRWVGR
#> 1823                          ENKIAPVFQGDLKPR
#> 1824                         EIKVRVEGQLTMNSLR
#> 1825                           NARLWEIKKRYTDR
#> 1826                                  RYGWQLR
#> 1827                              LDEVMPLKKAR
#> 1828                              RLDKLEIRWLK
#> 1829                         SAVMGVTRLLANEWAK
#> 1830                 QTFDGQGIAQAMSVLRRWPTLLRR
#> 1831                       KLGDDLLAAVVPNREVMR
#> 1832                          QLRLLKYVAYHYSGR
#> 1833                             QITKRIINAVSR
#> 1834                      KEQPLAQQDLIWLQNDVIK
#> 1835                                 TITLTFDR
#> 1836                          GVRGRLQHLQALGLR
#> 1837                           THPAERKPRRRKKR
#> 1838                           THPAERKPRRRKKR
#> 1839                      NDPYRSARWQAITLTLAMR
#> 1840           KGRFELADGGTLFLDEIGESSASFQAKLLR
#> 1841                                RWSTLNKLR
#> 1842                             GVWLHKIAAGIR
#> 1843                    KAMSLAEKIDHFALSESIFYR
#> 1844                                  LEWFLGR
#> 1845                        QPNDASMGLSLYSLMAR
#> 1846                         ETIIVHEIPYQVNKAR
#> 1847                                   KRFAQR
#> 1848                                ARENAPVTR
#> 1849                            DLGAFLLLVIAER
#> 1850           IEDEYFTPQYFDSIQTLTKLTSELILESNK
#> 1851                              REGGLIPRKPK
#> 1852                                 RFQPDYRR
#> 1853                 VNTTALLQNRADFVSITRIIASHR
#> 1854                             TKSTRYLTYSQR
#> 1855                 YVLLPNAYRVIVPPLTSEMLNLVK
#> 1856                    LTIRNNKKNSAIDLDENGSVR
#> 1857                       QREWYQADLDRWVLAIRR
#> 1858                       ADEDTQPLISHLIELRKR
#> 1859                         KAEETARLKVEEEARR
#> 1860                            AVRPSRIPLIIGR
#> 1861                  MSEKNDNFRQRVFQIVAAIPYGK
#> 1862                            DLTKYFYDAIIFR
#> 1863                        FELFLIEMIFVEMTLSR
#> 1864                               KEIILNKNEK
#> 1865                               KEIILNKNEK
#> 1866                         LWITETIFPIIPHALR
#> 1867                DAINQALYRDRLRELNGDVANEQER
#> 1868                            KAELVIRKSLYTK
#> 1869                               RITQPTVVRR
#> 1870                          NDSLSQLIARELQAR
#> 1871                              YTELLSLAKER
#> 1872                            QEDQRLPSGLLER
#> 1873                           EIRDAKIVYANRLR
#> 1874                                QVENNWTLR
#> 1875                         QVIQASATRVPMAEYR
#> 1876                               SSLDNVYWKR
#> 1877                        MIQAIGRLTEKLPVNDR
#> 1878                               RTTDIGAALR
#> 1879                  RTFGRVAEEITSYAVVKRLLNHR
#> 1880                          LTDWSSMTMKVSRTR
#> 1881                               RSWWLKWLGR
#> 1882                                 TALFVQER
#> 1883                          DINRRMSIGEAKARR
#> 1884                     IALPKTPDLPVFDIYPKLWR
#> 1885                            LRARFTQDDPLLR
#> 1886                      ELIHQMTIVDQATSPEQTK
#> 1887                        RQLLPMLELIRAAEEVR
#> 1888                          LPTLAGDAQRFSYLR
#> 1889                            LLEKVRIPAAKSR
#> 1890                               RAWDFGAKLR
#> 1891                         KERVIYHVSEIPKPAR
#> 1892                         ELLYRLLQGPQGRLLR
#> 1893                         VGTQLLEHAEVRGRAR
#> 1894                                  HRKIENR
#> 1895                    SVFSQLESIQAKKKANDSLLR
#> 1896                               EREGWALDKR
#> 1897                                  LNFFLKR
#> 1898                             QTLDAFVKRSTK
#> 1899                                   RLDLYR
#> 1900                                QELARRLRR
#> 1901                       QKIQSGDYPVGSRLPPER
#> 1902                            FENLPLLIRSALR
#> 1903                                REAYLRRTR
#> 1904                RVDADKGAWGNILLWDTVEAATLVR
#> 1905                           KLQDVEFYWSPVKK
#> 1906                           RRGAVRKAKLYYLR
#> 1907                       LDTQSTRMKNGIEDTIAR
#> 1908                                 MVDITRVR
#> 1909               AGTNRGLEARDVAIFYERLIETIEKR
#> 1910                               TQVQRVIELR
#> 1911                           QRYPINIRYPRELR
#> 1912                      QGGSVQSPLRDLLDTLGVR
#> 1913                             RGGTIMFSNNKR
#> 1914                              KTQPLINVWYR
#> 1915                                KVVFALLGR
#> 1916                KAQEEKARVKAAERAEREARAKAER
#> 1917                     RSYSDPHWEKAQGTVMAQEK
#> 1918     ATFSFGYGLMVTPLQLARVYATIGSFGIYRPLSITR
#> 1919                           MFRADRLRLVPHLR
#> 1920                                RYKKADQNR
#> 1921                            VIDDFPKLVQELR
#> 1922                             TQIRERVEEAAR
#> 1923                            RFLGESAGLVAER
#> 1924                              ADVKEAKWGLR
#> 1925        LIALGYLDNITRQVNSVMFEIASVDLSQPDNVK
#> 1926            DLEEVLPARTERSKPFTNAALFVGAAGDR
#> 1927               AEPAWVKGQLLADNQRLVDFVDELSR
#> 1928          SVDNTLLLIQMVAARMGIAALPHWVVESFER
#> 1929                                   TKQKFR
#> 1930                            MKLNLFRLTRLKR
#> 1931                 SASNQGIASPANISKQETTVSKER
#> 1932                      LALLVLVGWRSTVDRLITR
#> 1933                                 TAPKNKTK
#> 1934                               RIKRSTKTNR
#> 1935                           KAAWPSMITGLYRR
#> 1936           DFLRYGVEEELGAILSSFAPQSLNIKQAAR
#> 1937                   MLTLTFLVKTLVDLYVMVLLLR
#> 1938                NTTAAATEQDTRLALLAELLQLQSR
#> 1939                        FKNKKKEARAQKAVAER
#> 1940                  TYVDLDPMVPYSLKAALQIGQAK
#> 1941                        RLRSFLQELYSLSIGQR
#> 1942                      QPQPTPKPATTSKKVPTKK
#> 1943                          QKLQEKVKKELVARK
#> 1944                               LHERVEALIR
#> 1945                              RNALEKAYLDR
#> 1946                                RNEWLLALR
#> 1947                           GLPMRRIVLRHALK
#> 1948                                  YDIEQVR
#> 1949                             TQVASVFINRLR
#> 1950                                RRSKSAASR
#> 1951                  RVSPTDDIRKEFSDLSSLWRGLR
#> 1952                              RIELRTTRFER
#> 1953                           LYISLLILIHRLWK
#> 1954                                 TLYLGIGR
#> 1955                           EHLRPFLDYVRAIR
#> 1956                            KSARSVTMIANWR
#> 1957                                FRRRKHYRK
#> 1958                          TDPLESLRTMQAIRR
#> 1959                           RLAGYRKGREISDR
#> 1960                          QRGIVWIVDDDSSIR
#> 1961                                  RNMIRFR
#> 1962                                 RTSRIVKR
#> 1963                                   LRYPFR
#> 1964                         ETLVTFPSPTEKIAIR
#> 1965                               LLNEKVRGLR
#> 1966                          KEMLISEVRNNEVRR
#> 1967             SALGGALMNPIYGTARVAEIVKNVTEAR
#> 1968                                YDSTTAEIK
#> 1969                                  EYLLQAR
#> 1970                                RESQTLHYR
#> 1971                MEIVEEVAMPSIRRMVAKIRAVLEK
#> 1972                            EKREQIKVSTHPR
#> 1973                      LNSIFIHKEHDPLAQYDIR
#> 1974                                NNFLRESLR
#> 1975                             YRLLVRVPKTVR
#> 1976                           LHIIHFEEMLENAR
#> 1977                              KVVSFNINGLR
#> 1978                          VWLAFRMTTLELSDR
#> 1979                               RAPHAANIAR
#> 1980                                 HLDPKRRR
#> 1981                     QRLTDLLRYFQRTQADAALR
#> 1982                           RIDSLTNNIITIFR
#> 1983                          QGEILSLRWEHIDLR
#> 1984                        QLAAATQQEGKTVHLLR
#> 1985                               RDALYDLAQR
#> 1986      LNNGQRNFRIRWGFTMGAASLLIAVAGALQMGDLK
#> 1987                                  KNLFLGR
#> 1988                            IVPVALLGYPTGR
#> 1989                    EYGIYILIYIVVFVHQDWFTR
#> 1990                                  RYGWQLR
#> 1991                             RLAVLRTQYQDR
#> 1992                        RIEDPTPSYTDSNFRAR
#> 1993                   RVIDAVIALAGVANSMKDEVPR
#> 1994                        IDGFRKGKVPMNVVAQR
#> 1995                  QLKAYRVSADPTISFVLRDIGPK
#> 1996                               RLQNPAPLNR
#> 1997                                 RAFIVTDR
#> 1998                                 KPQTTRHR
#> 1999                    AGFRDAIAGGFIGLGQQIFQR
#> 2000                     QQGTTLFMTLLAAWSVVLSR
#> 2001                               QRLFFRKSRR
#> 2002                          RMINALHVRDLTTLR
#> 2003                               VKRFSSQPAR
#> 2004                           TKNLATTLNNYEDR
#> 2005                        YIAQKQANIYSLSDIAR
#> 2006                               APKPPEKDFR
#> 2007                          EQLVFSWLNSLSPLK
#> 2008                          QPNIHWKEANARLTR
#> 2009                          TAPFIYDELQTLPKR
#> 2010                     YPDLSLHRAIKYLLSDRHER
#> 2011              EIPPKAEKPNVLQIAIQSEIKVFFRPR
#> 2012                           NSIKIDKPRKVYKR
#> 2013                         ASAAAVLMSAHLIVRR
#> 2014                               KPGEVRFTRR
#> 2015                               KPGEVRFTRR
#> 2016                               KPGEVRFTRR
#> 2017                                TKKQAQETR
#> 2018                             MLITAYRERQTR
#> 2019                       GSDWREHSATRIDDVMLK
#> 2020                               KRTDSKNKIK
#> 2021                                   MWWIRR
#> 2022                        LLFWLPNRHRNMPLGER
#> 2023                               RYLLDTEQAK
#> 2024     DLSDRITDFLNNITLDELVNNKEVLNVADRQDTDTR
#> 2025           KIPLGLSKALLGATLDGFNGSPVSVVLQNR
#> 2026                         DFLKLNLADEFDKILR
#> 2027                      VELYKKRHDRLDLLQQDLR
#> 2028     ATFSFGYGLMVTPLQLARVYATIGSFGIYRPLSITR
#> 2029                                 RLEFITRR
#> 2030                      QIDVILHAKELQELESSWR
#> 2031                               RFAGLKERRR
#> 2032                              PMRRIRSFVRR
#> 2033                              RKLLFRDEIRK
#> 2034                         ILYEELGVGAVAITDR
#> 2035                     TKEDATRYILQVAQANHAKK
#> 2036                        FSQAADQRFKQFNDSLR
#> 2037       KNSDYSLFGPYRDVPMKLFSVWIEESLSDLTSLR
#> 2038                              IFYRRRRRRVK
#> 2039                           FNLIEISNLAARRR
#> 2040                              LPVERERRRVK
#> 2041                          KELREYKTIAENKAR
#> 2042                                  HIERQLR
#> 2043                       LDQEALNFRQKALVVISR
#> 2044                         KTALGLFIESVGINLR
#> 2045                            ITYAEGGQTFSLR
#> 2046                               RRKAKPKKEK
#> 2047                                IDKKSLRQR
#> 2048                KRAVQSEKRRKHNASSRSMMRTFIK
#> 2049   GWAFPGHSNVLVAPVDVPSIGRQRFTEVIVTGTDWEYR
#> 2050                              RLRSIAVDISR
#> 2051                EAIGELALLQVVKEALQRPPMGLKK
#> 2052             EVTLLGQKIAYLPIAHVLDRLTIGPQMK
#> 2053               LPKGVFNPYTSIKTNILFFTKGQPTK
#> 2054                  ERIVADGIDDPTFNPANVGQYLK
#> 2055                          HAPINLDVDIALAER
#> 2056                      FGLMLKILAGYINDEPATR
#> 2057                               QKLMIQIVRR
#> 2058                          EGVEAFIHHAKLVRR
#> 2059                                KTTLKTTTR
#> 2060                          RWRKNWFSAPIRQER
#> 2061                     SLRNDGTMAGMKRGELLVRR
#> 2062                               QEPYNFTVDR
#> 2063                                 RRRPKLKR
#> 2064                                  RLYIRRR
#> 2065                                DGNFFRVKR
#> 2066                               RVSLLSASFR
#> 2067                                RRFIIEAWR
#> 2068                         ELYRRVASLFMEINYK
#> 2069                               KIPWLLRRAK
#> 2070             GTAGKAKGSRWATGAIDLHAWSYKRTFR
#> 2071                          KSREKVRIDNNAWLR
#> 2072                                  YLIDNSK
#> 2073                              EVIKRARQKLK
#> 2074                              AFEAALADDPR
#> 2075                              RARHVITENRR
#> 2076     AAEEMNERIHERLHTDEIQAKTFHALALHIIQQASR
#> 2077           LLNNLQESPSLETLADELNLRRETIVRQFR
#> 2078                                IGEGFKANR
#> 2079                        AFTVAKVTRLDILEDIR
#> 2080                       ASLARSESQVKQAESLVR
#> 2081                            ETIFNLKLPMKKR
#> 2082                                  WTLLIIR
#> 2083                   VAAYLRSWLGDGLSKTVILGQR
#> 2084                           RAAENEKTRKYVKR
#> 2085                           RAAENEKTRKYVKR
#> 2086                               RLASSPLLNR
#> 2087                            KHPLFKEFSAPFR
#> 2088                          GVYSRVRLNSEISRR
#> 2089                       GASLDLRQQQIRRLLQTK
#> 2090                          NRWLALPFLPEQTRK
#> 2091                              RRFSLLVATER
#> 2092              PTRGQGTWLKENGNEDIYKYKAPRPER
#> 2093                     RNDKVLNSLSALNEKFGYER
#> 2094                                   KMRQLR
#> 2095                                 DIGKRLLR
#> 2096                         GAEKLREELDHLKSVR
#> 2097                   LHLVAAGGPIDFVRSGVDLALR
#> 2098                               TREESREFAR
#> 2099                       VQTASVESQAEAQKRKTK
#> 2100                           TVVFELLWDKVADR
#> 2101         TANDALAKSESFGIVKGSIDGITSTKVSSTNK
#> 2102                    GVEAATLGVDGTLAGLIDGPR
#> 2103                   KISLSSIRVLLEGTAFESDIQR
#> 2104                   ERQVKYDFSKPYIDSKAVLVVR
#> 2105                         TRRTPLQQTLSASARR
#> 2106                                 MSKIKIEK
#> 2107                      GNAHYQEITDENHIGTLLR
#> 2108                               TAKISQVINR
#> 2109                           KERSSLFRDRPVKR
#> 2110                         EMAHQQIGIEVLNRVR
#> 2111                                  RYERLLR
#> 2112                          KVARTMARRAAEIQR
#> 2113                            SAALTERLVAVAR
#> 2114           LALGVSNVNYYLAADHHKLYDEFEPKGILK
#> 2115                           MSPYLPVRLFIRQR
#> 2116                          VNRTWGEESEQVAER
#> 2117                               GVYIRTSKRR
#> 2118                            DITQMHQLEGARR
#> 2119                PGIRLRTLGKAIQQFAEGNNFSVVR
#> 2120                                  RARSRKR
#> 2121                   KEMGSGALQQVQQKTMGVKVDK
#> 2122                         KERSDEIPEAAKIIMR
#> 2123               KWNEAFARVSRLLAETESAQPQFGLR
#> 2124              LQDAKGSVVERQAELDANNKVQEERAR
#> 2125            GVKKTSWANKLSAPNHDASSESVPADSLR
#> 2126                                 RQWRKRVK
#> 2127                                 RQRYIAAR
#> 2128                         EVQRIIAEPMFLLALR
#> 2129                              EATKRYRRHRR
#> 2130                            RLMNDKRKTIGLR
#> 2131               DLATKGEGLTIKLTAGDYNGKGDNLK
#> 2132                   VNRVWLAFRMTTLELSDRHLNR
#> 2133                             RQGSVRLHRPSR
#> 2134                             VIARLRRVGLHR
#> 2135                          VKENLLRLQMHAEVK
#> 2136                                  RRREYRR
#> 2137             KVYTRTKRVEIQVSKSKGGTSPVNLTSR
#> 2138                          YSLRDTINQVYKSAK
#> 2139                     GTGKQRWPKKGSGTVEARTK
#> 2140                        AQYVLMVQFIPNIATTR
#> 2141                    LGGNSLLDLVVFGRSAGIHLR
#> 2142                  ESATSGSTRRILNDIDSQAVFDR
#> 2143              KDIDALTKTLNSAFNDPASQLLIDGVK
#> 2144                  LEERSRAFAAYLQNQLKLQKGDR
#> 2145                           QTDGWVPMLGGRQR
#> 2146                 ISIDQGNLKVEVGAPIVVPAKAVR
#> 2147                        VTTGTALAVGDAIARIR
#> 2148                               QLVKIYHALR
#> 2149                                  QVKVLRR
#> 2150                         TLEFGLVRDEALFLNR
#> 2151                   FSLAVLLSFLLVTLAQAAEPSR
#> 2152                          KQAKLDAFDKEAEKK
#> 2153                       KEGIEQYYEERREAVVKR
#> 2154                              AQEIIIRLFDR
#> 2155                    SSLKDMKELPTVQTIEYVPSR
#> 2156                                 RAFRSLQR
#> 2157                             KEVGYIQKQLTK
#> 2158                          FANYQWVVFQEKLNR
#> 2159                                 LLVFDKVR
#> 2160                              REFRTTRLEIR
#> 2161                        EPAGVVELSVKILRVIR
#> 2162                            RPQTHGILGHVGR
#> 2163                                LTHLLTTIR
#> 2164                       IIYPLVRLVRRIGAQLQR
#> 2165                               KFVRIKQSVR
#> 2166                            LADRQTLYDKPVR
#> 2167                             QQIRQAVRQQRR
#> 2168                             RLSLWDAEARRR
#> 2169                              RNREKENLVQR
#> 2170                     ESFSPLRKLRFYNDYYFTLR
#> 2171                      EFTLLDAPPLASPDAKGIR
#> 2172                         FQRAFRENIIELAQLR
#> 2173                              LRTFVEVYRQR
#> 2174                QMLDGLVDQRVSAGYRQAVVNMPVK
#> 2175                           LDIFLNTLQKVIDR
#> 2176                              HTRHYLAKLIR
#> 2177                      VTQNISRIMSQKASNLHNR
#> 2178                     QTALPTSEDPSRLQLEAAIR
#> 2179                                   LYRERR
#> 2180                               RYRGAFVAAR
#> 2181                           RLLGQKLIDEIISR
#> 2182                LREILRVIILSHGGLEFFQDHRGVR
#> 2183                      IKMWEPKRLLEQRETVVTR
#> 2184                                  RLSGKIR
#> 2185                              IPVHMIETINK
#> 2186                                TMAQLRQER
#> 2187                             ATGIELGVVLKR
#> 2188                              IKKELKRFKKR
#> 2189                               RALFLDVQRR
#> 2190              APSREWNKETPFHPAYYYEHFELPGRR
#> 2191             RTSTTQVANSTKPTLAENVAKMQDGINK
#> 2192                                RYRWSWLHR
#> 2193                                RYRWSWLHR
#> 2194                          RFNLRTGDTISGKIR
#> 2195              LYARKQQYLIRQDEIQGHISLSEALKK
#> 2196                     KTGDANDSALDDLLFDLLTR
#> 2197                  QLKAYRVSADPTISFVLRDIGPK
#> 2198                          FIETLQGTAFPNSKR
#> 2199                               RFVFINENPR
#> 2200                         ETNNDPVAHYLTALDR
#> 2201                     QQHRIHDLLLNNATKYLYAK
#> 2202                                RRFNLKLLR
#> 2203                           KKYLEVRLRSLEQR
#> 2204                                TQSDLILSR
#> 2205                           RSMEEKLRSMVLVR
#> 2206                           KTENNQKQTPVPHR
#> 2207                             VSLNIDHFVPLR
#> 2208                                 LKKIFNSK
#> 2209                QPNVDVVTGVDAKQVVELFADLLSR
#> 2210                NETIISIARRGGTSAQQDVEKILGR
#> 2211                                PSMVVLPRR
#> 2212                           LGTAYLVELMAKDR
#> 2213                              WRKNWFSAPIR
#> 2214                                  QIQLIPR
#> 2215                                 KKLTLLTK
#> 2216                              KIMRTDDHFGR
#> 2217                               HHDNIQRLWR
#> 2218                                  RLYRVRR
#> 2219                                 RSISQALR
#> 2220                    ELSAIMADLSNGHEHLRRLLR
#> 2221                GYLQSKLMASGPLSDHWAGRINLSR
#> 2222                                 RGFVPRKR
#> 2223                     TGADMWGLFVLKSKSSHTIK
#> 2224          LEAERRKQDKRGQASNAVNEKPTEDAANEQR
#> 2225                               RGILPLIVEK
#> 2226                 TNLISRQELDTQTAAVRQAEGALK
#> 2227                      KNVAPIVNDWPSRPEKNTR
#> 2228                        QIRYQARAVDVNLLTQR
#> 2229                          KMLMQQRQWSLENNR
#> 2230                           KVTYRIHFKRVINR
#> 2231                        QLRRGMQNTPDLRERVR
#> 2232             DDAATLSAQLPANWVLSLGVINGRNVWR
#> 2233                                RVNRRWSQR
#> 2234                              QEFLEIIHSHR
#> 2235                       REAELRTQTQPLRKQITK
#> 2236                     YLTLIQSITLLHQYQREVKR
#> 2237                                 RLRSASDR
#> 2238                           LKDVLLSFSLGEER
#> 2239                         EDLESLIASIRRLSVR
#> 2240               IVVRLGFPTSPVALEGLLKHEKVEAR
#> 2241                                 KRLMKLWR
#> 2242                               RSADAYRRIR
#> 2243                      KTALGLFIESVGINLRSAR
#> 2244                               GDVLKAVVVR
#> 2245                              RIQTRLTRRVR
#> 2246                            DRWLTFHLKTIER
#> 2247                          VMHHYADRLVLGKLR
#> 2248                             FVIRKMKRISRK
#> 2249                                ARDFAIRRR
#> 2250                          TDPLESLRTMQAIRR
#> 2251                                  AKREPDR
#> 2252                                RVLKYTTGK
#> 2253                             VGKVGAQDNVRR
#> 2254                               RLSQLAAHKR
#> 2255                          KEPEPPLLANDDVPK
#> 2256                  GNLIALRELALRRMADRVDDQMR
#> 2257                    QTHTTGPFNMVRSLRQKWNLR
#> 2258                                ERKRDKKHR
#> 2259                 WDNLAQIALGHSQAAAALSQDNGR
#> 2260                        AKNRLQNGWGRHLREIR
#> 2261                                ETLLAHLNR
#> 2262                                RHQRLDMRR
#> 2263                                ELKQRIRQR
#> 2264               NIESESKLLLLLQQNNLYGNLEDILK
#> 2265                               QRRILPQKLR
#> 2266                                LLRYIRYVR
#> 2267                                  TLQRLFK
#> 2268               DANLVIIYDGTDVHPTYEAKHKGRLR
#> 2269                           HYKGRIIYNIGEKK
#> 2270                               RFLSSTVPLR
#> 2271                           GAKIIFMVAINKPR
#> 2272                        RLRSFLQELYSLSIGQR
#> 2273                    ILTPALLNEIAGERSARFDNK
#> 2274                              RKEAEVNQQKR
#> 2275                             DAENVLRSRGLR
#> 2276                   LEYKLLWDQFGRLDALSYKGSR
#> 2277                          ARKLRLKRVQQLLEK
#> 2278                        RMIYVGATRHLVVLNPR
#> 2279                            NRTIPLSNLVPNR
#> 2280                            QLNTLKELSQVSK
#> 2281                            EILETGRSVTLNR
#> 2282                         EIEALIQQRKDARATK
#> 2283                            VPFEVVLRRPAVR
#> 2284                  VADTRQGQQEFYVSLNRVEVVRK
#> 2285                              FVIRKMKRISR
#> 2286                          RLMQAYMDPTVGLRR
#> 2287                              KISIIKNLVYR
#> 2288                               RTFRVEGPKK
#> 2289                               RTFRVEGPKK
#> 2290                         PEPKPVKKVEQPKPVK
#> 2291                    SLQPAPNLRQRMRYLGGFMAR
#> 2292                             GMYFELSLYYIR
#> 2293                   PGRVPGTRELVLTHYPYIIPYR
#> 2294                              NLQRARRILKK
#> 2295                        SRERNNRSGLIGSLIDK
#> 2296                     VIYNFAINRPRNEAATPVAR
#> 2297                  QVSEAILSEIEKAAQASRQALNR
#> 2298                            SAARSLHKVLVIK
#> 2299                 ETAEKAKRAADEQAKREAAEKAKR
#> 2300                            AGTIWFATPATER
#> 2301                             VDAHHAIIPTAR
#> 2302                                  RIFLRKR
#> 2303                              NVAFGLHLHVR
#> 2304                           MMIQHLREGALARR
#> 2305                          QQEGGSLQAPLHHLR
#> 2306                           QRDAFPKEATTLHR
#> 2307                          LVSMVSAGMTLLNPR
#> 2308                              TAQHTILKIRR
#> 2309                         LWTLAHAVLTVPYRLK
#> 2310                                  SSRALER
#> 2311                                  RYWLLSR
#> 2312                          LFPEITIKSQSVRLR
#> 2313                            RYLPMQGGEFGRR
#> 2314                       KLNTNVSQYTKSGIAPAR
#> 2315                     KILEVMLRKLIDLQNSHYIR
#> 2316                          NVRVGFPPALNDKLR
#> 2317                              RLLFDPRFYYK
#> 2318                            SQAASLWLEIISR
#> 2319                        VLWLSLAFTLLIMTVAK
#> 2320                       VQTASVESQAEAQKRKTK
#> 2321                        DAQIQYVSQEQAKLAWR
#> 2322                        LREIIPPLATIVQDIEK
#> 2323                                  MVLQSTR
#> 2324                          TTKDGGVTQKKDKGK
#> 2325                               LNKIHSDITR
#> 2326                         LSELPDTKIPDHLVLR
#> 2327                               FEKRLWSNIR
#> 2328                                 RQKPFLVR
#> 2329                    QKLESSLGELQQLSGLSGQVR
#> 2330                               VMSKLAEAAK
#> 2331                              ATTTITIDLGR
#> 2332                               FIRSPQSLLR
#> 2333                                  RWHRDKR
#> 2334                   KVEVLPLPALLEGTDLYHQIER
#> 2335                        SPLLPQLGLGADYTYNR
#> 2336                           ELVGYIRRVKQKER
#> 2337               NRRQDDRQERSGRDRRNNGQRRPNRR
#> 2338                              VVRARWIIVKR
#> 2339             EVPHLLLAHHFSPVLPAGQGGYALDRRR
#> 2340              QMSIDSDLRAGLIEAHQARQRRENLAK
#> 2341         DNNLPVSDVFAMAQVEGRDKPLSNLRSGQEVK
#> 2342             ADVENRDSVQRLVLAFHNGRLTGIRLKR
#> 2343                           RHLRREVGNDKVLR
#> 2344                         EEAAMRTEELRITVER
#> 2345                                  IDLNFNR
#> 2346                               KVLAKRKEKK
#> 2347                              GFRLRIRQPER
#> 2348                     HGGLMAVIGESGAGKSTLRR
#> 2349                                   LYRVRR
#> 2350                                 FITRFIIK
#> 2351                           GEPLVRKGVDMAMR
#> 2352                                 RRLIDRQR
#> 2353                                DIAQRLLQR
#> 2354                         DALFLPGMTPQPLAFR
#> 2355                               KPTARRRKRK
#> 2356                 SGASHGRHKKDRKRERAERELEER
#> 2357                                  RMRRIRR
#> 2358                      RELEAYIQELTLDKLVEYR
#> 2359                              RVINRNNRLKR
#> 2360                                   RRYRDR
#> 2361                  QITNKPPLPYTRGFRLGNMPQIR
#> 2362                                 WRDAREWR
#> 2363                      VQTPSLVTVTQVMNFLSNR
#> 2364                          KISNLVDDEFYFSRR
#> 2365                       EAALQHADIDAQHSDIIR
#> 2366                       QVAHYLKQAAGRAIDVAR
#> 2367                        PFALTEVAARLQALIRR
#> 2368                                RIDWTGAVR
#> 2369                        MLDALDDQELVKLIGER
#> 2370                              RQLEQKQTQQK
#> 2371                    QGTGSLALRLADSLRGIAHGK
#> 2372                      RIVLATNVAETSLTVPGIR
#> 2373                           HYKGRIIYNIGEKK
#> 2374                           LQHSRGTIPMLKVR
#> 2375                            RQDPLSVATLRLR
#> 2376                              LYASTERQLAR
#> 2377                         YAVDLGDFVKKANFSR
#> 2378                               RALFLDVQRR
#> 2379                           NRNRNVKIVDPMVR
#> 2380                            KRRRPKREAPHTK
#> 2381                            KRRRPKREAPHTK
#> 2382                           VLLMRQATIIKSNR
#> 2383                    EIRSLSADIMTGIEKAATASR
#> 2384                                 RSMREKIR
#> 2385                        VNLKPGQTLIVSGYNSR
#> 2386                                TRKYVKRPK
#> 2387                            QQNDTFIEAAAFR
#> 2388                               KKKRRATQKR
#> 2389                       HSMNHEGNATMGEAITLR
#> 2390                         QKLLETVKQGHSLQKR
#> 2391                              RLHGINYEKQR
#> 2392                            IVSQGNYTVMVVR
#> 2393                     RNQWVKQQDFLTRLPTDSMR
#> 2394                               KKIPFHKEEK
#> 2395                          QLASYLQRLEEASKR
#> 2396                               RYTGAQLIVR
#> 2397       FDRLSESNITIKFDHGQYRTFWIAEKSFLHFSLR
#> 2398                         ATDLGIKKMAVDFRRR
#> 2399                               ELHYWLLRSK
#> 2400                              EKIKEIARQYK
#> 2401                           QVAGVAMPAPVPLR
#> 2402                         DMAKRFYILLYLFLSR
#> 2403                                  LFYWLRR
#> 2404                     EKLSTVAVSRLNDIQALLKR
#> 2405                   QAELDANNKVQEERARVAYQNR
#> 2406                       TKAEVFSLKKPQSVTQRK
#> 2407                     GFRQSGFYNPVGSAAIQALR
#> 2408                    ERNDFALLSNLLYADGQEQLR
#> 2409                                 RVSAKRLR
#> 2410                              HVDQALKELRR
#> 2411                       FLRKDFLNDIGGTVSLNK
#> 2412                   MVMNILTKIFGSRNDRTLRRMR
#> 2413                 KEAGTVGARSVLYTYGRGYSAIER
#> 2414                    ERHNLMSRGYSTWDRVEILDK
#> 2415                                  REVVKIR
#> 2416                              MMIPMINEVAR
#> 2417                          ELASRLEVKAQEFLR
#> 2418                          DVLLSFSLGEERLRR
#> 2419                        LAHLFREQVGINILRWR
#> 2420                             ERAKRLRWEALR
#> 2421                              RRFWERLFVGR
#> 2422                            IMPLSRFASVLQR
#> 2423                         KRLDYLSRRAQILAIR
#> 2424                                 RIIQVHVR
#> 2425                             RAVYEPLLQYSR
#> 2426                       DSLLYKIARHLSLDPYRR
#> 2427                      ELVTLFNDPLRRSSDVKAR
#> 2428        RNVPFDVIGASFYTYWNGPISALQYNMNDVTKR
#> 2429                         LFYQQKIYLLLPELQR
#> 2430                                RPLLGTRRR
#> 2431                                KKLFEQERR
#> 2432                              RWARHLLTLLR
#> 2433                            KTRRRVIFKDTRK
#> 2434                        ENTKAIIRKEILEKIGR
#> 2435                        ENTKAIIRKEILEKIGR
#> 2436                            NGAAAMKAFIVTR
#> 2437                              TNMQLLGSDVR
#> 2438                                   RKRHLR
#> 2439                            LTLEVHESWSERR
#> 2440                            GRGSINRLTRSLR
#> 2441                   FNTILIDFDRDIWGYIALNHFK
#> 2442                RRPEIVEGSEHVLEADAVIMAFGFR
#> 2443                          RKGKVEMRYIGVNQK
#> 2444                           RRIDEWQTLLVNSR
#> 2445                                  RSLSGRR
#> 2446                        QLSFFWRPEEVDVSRDR
#> 2447                                 KQTLLSLR
#> 2448                          LLNATQWQNRPYWQR
#> 2449                    PHKPKERQDRSGGSDRRDGRR
#> 2450                             TKEQELSRLTPR
#> 2451                                 AKAEERKR
#> 2452                            MSTSLLKLTGITR
#> 2453                        IREMAENDPRVVALVIR
#> 2454                        QALLEILQLDLASIRER
#> 2455                     VFEPIDSIKNNSIYFNEVAR
#> 2456                       QRYTDKRYTNRHSDYVPR
#> 2457                   KNTFSSPVAPANPATEPALMRR
#> 2458                              DLFQKRSLAKR
#> 2459                              RLLLYITEEGR
#> 2460                              EYLSLVIQRNK
#> 2461                          MPLMMKRSVKEGRGK
#> 2462                            TQLIADLAALAAR
#> 2463                        TQQLLQKRLHEQPMRAR
#> 2464                      QVEQILTAVFTINKRLKGR
#> 2465                       DEVESLIPGVTNLLVLLR
#> 2466             ASHLIDFLLIGNNFGTPEMRGVWSEHNR
#> 2467             LIDSASEGIHQTHSAIYRYLEEDVEITK
#> 2468                          ASEQSGLSAELLASR
#> 2469                           QYFPFLHNFQPVNR
#> 2470                    LHPGDRVPSVRSLASELNLAR
#> 2471                              MNVSPKTIENR
#> 2472                                 HRREVVTR
#> 2473                                 RDKVRGLR
#> 2474                             RIAKRAGAGLGR
#> 2475                                KKFRKLEKK
#> 2476                          LVLDSEFTSRVSIAR
#> 2477                                RTRYQAEVR
#> 2478                               RVMFRRAMKR
#> 2479                   GATSIQESVDAAPIMREALSVR
#> 2480                              QPFREAVDTVR
#> 2481                          RIINALLFDIIESTK
#> 2482               EILFNLPMNHTSMMFMEAIDDPDILR
#> 2483                            RTPVNFVMKRLPR
#> 2484                        KAWAVWNSFHEPAIENR
#> 2485                         TILADHRIKQRSLRLR
#> 2486                                  RLKFAFR
#> 2487                          IRAMTVLEQRYPRRR
#> 2488              KYEDFDIGEIDKLITLVAIVFKIKEEK
#> 2489                 ETLEIKYKGKGIHEVLDMTIEEAR
#> 2490                 MGLKTRRWIVDDLTVAWEKEVLYR
#> 2491                         SREEIQHQQQINRAIR
#> 2492                        RQVALSFEGPAEVLWAR
#> 2493                              IEIFSGVSVNR
#> 2494                              YPNEIFNFVRR
#> 2495                                 IRLIYRQR
#> 2496                           TGVFLIKGKRSAIK
#> 2497                           RDLYHTSKIRRITR
#> 2498                      QAETAGAKEAKELAKRVMR
#> 2499                NSLYVSPISLRSLADRILSAERRSR
#> 2500             VAPRKAWYGALQLEYLAVDNKASLRQLR
#> 2501                                  RHVRRER
#> 2502                        MAVLIAHLLKWKYQPER
#> 2503                       LANTKAVVAEMWPRQLLR
#> 2504                          EMKASKLIVLSSWKK
#> 2505                    QQYLIRQDEIQGHISLSEALK
#> 2506                                   RESKRR
#> 2507                            LTNTADLIRLIIR
#> 2508                        GTLRRNIVEVAGIEIIK
#> 2509                          FANYQWVVFQEKLNR
#> 2510                              YVFSVGHVVGK
#> 2511                                REQEFLKKR
#> 2512                           RLDVKITPVVFIMK
#> 2513                   AQVGAAISMALLGLGFKLVRSK
#> 2514                                 RWRQEGKR
#> 2515                               LRVRKRTDSK
#> 2516                                 RFISQPQR
#> 2517                           QANRTLKDLLVPSR
#> 2518                              MKKIDYLMRLR
#> 2519                                RLHQVKRLR
#> 2520                                 YTRQRLGR
#> 2521       FRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGK
#> 2522                     KIEEMADTSNDQHIIGISKR
#> 2523                                RTLEIVRLK
#> 2524                       LSMGVQDFNKDVQKLVNR
#> 2525                          NDDPQAASRPWDKDR
#> 2526        DFFEKRNGRITERTDDVSKVSDPWPLTRRLRPK
#> 2527                         QGRTELYLVTAAVRSR
#> 2528                                  KRLFIRR
#> 2529                               RAQRILKGER
#> 2530                              ITKIISHTRDR
#> 2531                             VGNQRELESLWR
#> 2532                                   RFKRWR
#> 2533                      LLKNKDIDVELHTAGEFKR
#> 2534                            VSELISTLAAVVR
#> 2535             QNLDAIQKAQTRIFIVGDSTAATYEKGR
#> 2536                                 ESIKTLDR
#> 2537                             EVQQQYQEAAAR
#> 2538                   RASLEIDVQSTQKKRLIRAVEK
#> 2539                                 QVLYVARR
#> 2540                                AFRWRTLRR
#> 2541                   VIDTIFFRAELDQTRSFVNFVR
#> 2542                QTTVVAEAIALTHEISIYGLESATR
#> 2543                              YLVAREAMAKR
#> 2544                           IGRFEVPAGAQLGR
#> 2545                          DLVEQNRAALSDRQK
#> 2546                               MINRLMWIWR
#> 2547                    IANLVRERNQPKVTDINNLVR
#> 2548                           LTTAWFAQRVDERR
#> 2549                               LKDTALAATR
#> 2550                            LDVYDWATVLQRR
#> 2551                                  RSHPLLR
#> 2552                      AGYPKRQVIRDLSVPQLPR
#> 2553                          VNVFRQREGLSAALR
#> 2554                                 IWDKLRKK
#> 2555                 IYLNVLSSQAQAYQTAPSGYMNIR
#> 2556                            KTYRWNRPATTQR
#> 2557                            WLEQQEIADPYRK
#> 2558                                   RRRRNR
#> 2559                  QYQHLLAISQILTLYKMHDRRTR
#> 2560                  QYQHLLAISQILTLYKMHDRRTR
#> 2561                  QYQHLLAISQILTLYKMHDRRTR
#> 2562                  QYQHLLAISQILTLYKMHDRRTR
#> 2563                             VGLFAEGVAVKR
#> 2564                              QEKRRVSFHRR
#> 2565                                YYWQLIKKR
#> 2566                           ALQRDPDNAALTGR
#> 2567                                TRRQVNNLR
#> 2568                     KTLKDFTGDQSQIELDKLRK
#> 2569                           HLALSYLQYQLDYR
#> 2570                         QIAAKSVDLGYITMAR
#> 2571                               QWKERLKLMR
#> 2572                          ELYQAHNYTGRISNR
#> 2573                          RALIALDHQDEEEQR
#> 2574                               LNYLKAKEKR
#> 2575                        ITDASALQVNQVQLALK
#> 2576                       KLKNHKALEILKDMGNLR
#> 2577  RFVYNDPKKDKNQVNTNAVDIRYKGIPLWDDATLSLIGK
#> 2578                             EEARQQLLLQQR
#> 2579                LDLPPFTLIGATTRAGSLTSPLRDR
#> 2580                                QPVGRHIIR
#> 2581                           GELHILPLQQGERR
#> 2582                          QTPHILIVEDELVTR
#> 2583                 QFPVVYRPHEWTQSRLPDGTMHTP
#> 2584                         KRFLQQGIRTKVQAFR
#> 2585                                RIFFAGLRR
#> 2586                  WLSALLVLLLLGAIAHSVLNNPR
#> 2587                              TKLGRRRYPFR
#> 2588                 KLEERSRAFAAYLQNQLKLQKGDR
#> 2589                        LDRKALPVPDQTAIVTR
#> 2590                  VPLFVQIGEVVRVDTRSGEYVSR
#> 2591                        SGAILQPEVTNLLTHLR
#> 2592                          QAGMLVIYADNYHYK
#> 2593                               KGDAQLLELR
#> 2594                          DINRRMSIGEAKARR
#> 2595                                 RLETSVKR
#> 2596                                 RLETSVKR
#> 2597                   RLKAFLKRDYNGGYSKQNARPK
#> 2598                              TKDGITYYHIR
#> 2599                              NTAESLNVTDR
#> 2600               SHQGSFMIMAFLVTILLAVPTKGLMR
#> 2601                           GVRTFDDRQANAKR
#> 2602                              GYGQQMALLVR
#> 2603                       KANGWILYLIHEIVAPER
#> 2604                                  FLRQLTK
#> 2605                                  FLRQLTK
#> 2606                           TISSLVTGDRVVWR
#> 2607                          PKVKREEPTAVALER
#> 2608                    QTLDNNGNSIDDMADRIQLLR
#> 2609                    VENAAQQWQAETNAHIVALPR
#> 2610                          EKVIKNVHSFSYSKK
#> 2611                      RLRMILLFKDILSGILGSR
#> 2612                                 RLRRAKHR
#> 2613                  RHQPSPVLSQIGLFVWEWPDGPK
#> 2614                         TDIMPLDDLGIRQGLR
#> 2615                               RLWKIDPHRR
#> 2616                                IKRFEKTAR
#> 2617                                 QQHVRLFR
#> 2618                              SIITNLKLAER
#> 2619                                  QFRNYYK
#> 2620       YTPRAESDFAGHWRRFQALSQPETAPQGKKETTQ
#> 2621                                  FRLTSLR
#> 2622                                   RRQEVR
#> 2623                                  QGRVIDR
#> 2624                               FIKRIKRRMR
#> 2625                                   RLYIRR
#> 2626                                  WRQSERR
#> 2627                     TGADMWGLFVLKSKSSHTIK
#> 2628                      RGILMTQYYLQVDAPPLAR
#> 2629                             KRFPSLDRMKYR
#> 2630                                  RLRQRDR
#> 2631                                 RDVEIVIR
#> 2632                           RVLYVIADELGVTR
#> 2633                                NNPPRKIYR
#> 2634                       ELTTKPLFEDELWRKSSR
#> 2635                              KRRARITQKMR
#> 2636             ADVENRDSVQRLVLAFHNGRLTGIRLKR
#> 2637                            RILMAFEQPNNLR
#> 2638                       RQGKIWIRVFPDKPITEK
#> 2639                              VELRATNPANR
#> 2640                            IMFPMIISVEEVR
#> 2641                        KHKVEAAVIRLPAADNK
#> 2642                              QQQIRRLLQTK
#> 2643                                RLSRSREIR
#> 2644                      EEELTKRKELLARYAPHEK
#> 2645                     EWKKLGHPVREQFKKKLAER
#> 2646                        KNMIMYAYKLDGYQKLK
#> 2647                      RGKAMGALGGTLQNIVKEK
#> 2648                            KEKEKEKVKVKVR
#> 2649                                 RRWNPYER
#> 2650                            VGRLLRQLWQWWR
#> 2651                         QVRHNIARVKTLLTQK
#> 2652                              EVIVSHYDKVR
#> 2653                                 MDFRQPYR
#> 2654                   VREVMGLLPTVTDVMPNISQGR
#> 2655                         TESGVVEEGEKIAGTR
#> 2656                                  RTIFELR
#> 2657                               QRLWDIVERK
#> 2658                        QTEALLKDSGLPHVLLR
#> 2659                              RSIIRVKEGRR
#> 2660                           DGERVSLLARGTKK
#> 2661                                RMIYVGATR
#> 2662                              RTATRTRNRIK
#> 2663            DLEEVLPARTERSKPFTNAALFVGAAGDR
#> 2664                           RKVFYPRNALAADR
#> 2665                ASSESHKKFLENYIDKKSIISKIKK
#> 2666           DNWVVRLDLVTDEYYHTEPVKRVLVRYPLK
#> 2667                        KSRVDELELAQLSASNR
#> 2668                                LLRYIRYVR
#> 2669                                 RFSRLTRR
#> 2670                           ERLDQLIEADPRLR
#> 2671                              DLFQKRSLAKR
#> 2672                                 LDDLTKVK
#> 2673                               FPVKNHKVKR
#> 2674                    NEFQKDARTKVLRDDGYQQLK
#> 2675                            EGYVNLLPVQFKR
#> 2676                              RKTSKKTLIHR
#> 2677             KVVAAHPDKPQSWYLKSQIEERLMPSGK
#> 2678                             QLSKLLPYVLLR
#> 2679                               KATAGYRNVR
#> 2680                 RYPDRHQIQSDKSLYQFVAELKQR
#> 2681             HMLTSVKTGTYTMPVLHNRVSNEELKAR
#> 2682                      RHKRAILVNLPAMPFAQHR
#> 2683                               RTIFELRKAR
#> 2684                                QQLGQNLAR
#> 2685                            EKYIFQKMGVPFR
#> 2686                               EKIDVRNLRR
#> 2687                                  HRRAATR
#> 2688                    REKYPKIDDVIRVNLDLKNLR
#> 2689                     PLKDLKDAEVGGSVLVAHIR
#> 2690                         INLGNVAEDLLVTTHK
#> 2691                     YFEYELESIGLTVLETPMLR
#> 2692                           DNFIVSGEQPNLFR
#> 2693                               RLVRKTTLER
#> 2694                    MDKQIRLMIADDHVIMREGLK
#> 2695                               KLIFIINRNR
#> 2696                                 RTDRDFLR
#> 2697               IVVRLGFPTSPVALEGLLKHEKVEAR
#> 2698                       TLRSGYLEQNAILTLSPR
#> 2699                         TSVSIFPKAHGKLRLR
#> 2700                             RAGREIIVGVQR
#> 2701                                RVVLPQVLR
#> 2702               MLMRIAARSDGIEAVPAIVKATRHDK
#> 2703                                 RKYMKLSR
#> 2704                        TQEIRPLKVLVLNLMPK
#> 2705                           QKLLQDYLEALSIR
#> 2706                              QQVVLVGLLHR
#> 2707                               VELYKKRHDR
#> 2708                             LFRSRERMVETR
#> 2709                     VSSSENTATKSLQPAFVVPR
#> 2710                        KTQKQHTNTESLLARIR
#> 2711                        RVGAMPKTQQEIIRLTR
#> 2712                               EMVYNRLVRR
#> 2713                                 NRKFDVIR
#> 2714           QGKSLPSRDKQRYHRFLAYGLIGALFEPLR
#> 2715              ITLYEGRNRQVRRMTANIGYPTLRLIR
#> 2716                               RYRLVKMGQR
#> 2717                       VMKFLLHRIGPSNLLRSR
#> 2718                       MTLLALGINHKTAPVSLR
#> 2719                          RGEIDKKVVADAITK
#> 2720             MPHRSVQTFLLKSVNHRKFIGISLNLLK
#> 2721                                RHNKIRVLR
#> 2722                    NNVVNTMRLWSAKAPNDFNLK
#> 2723                          IIAMVLRLDSATPQR
#> 2724                       TKNLAVLLSWRLGERRVR
#> 2725                             NLHPEAETALTR
#> 2726                              EETLKMREAGR
#> 2727                             EVENLRVGFVNR
#> 2728                             GILHGLGSWDTK
#> 2729                    TGAAFLADSGWHQLSNSHWAR
#> 2730                     RGEITFLIGGNGSGKTTLAK
#> 2731                          AGPFFSLSINKLIHR
#> 2732                                   LFRVRK
#> 2733                      TQYQDRLEIVMRTYFEKPR
#> 2734                    QLLDAQFQMLWRNQTAGGDVR
#> 2735                  MAPLIDLLAGYAHTRLFAQEALR
#> 2736                    LLDYEPQIRLQNRLNDRTTER
#> 2737                                  RPIPLRR
#> 2738                                  RPIPLRR
#> 2739                               QTVAYELLFR
#> 2740                               RGSPALLAQR
#> 2741                          PLKKRESATSGSTRR
#> 2742                      PLAQGGQLNRLSAIRGLFR
#> 2743                             STQVKALASEPR
#> 2744                        FPVKNHKVKRFSSQPAR
#> 2745                  EAPTLRRDDLEFVKKAIFLSYFR
#> 2746                           KVEYLLRNQISIGK
#> 2747                           RSGVTLLNQSVLLR
#> 2748                                RYLQFDRER
#> 2749                         QFRQLLQKEQHSPRER
#> 2750                          RLWTRGLSQKLRWRR
#> 2751                            TLIRSALKDALKK
#> 2752                                  RLFTRAR
#> 2753                               KPTARRRKRK
#> 2754                               KKLSKGQQRR
#> 2755                         QAYPPLVVVSRSHADR
#> 2756                        QIDDQSLRGWLSLWPSR
#> 2757                       DNLEKKDADNLEAWEVTR
#> 2758                                 RGLLNRLR
#> 2759                      AGYPKRQVIRDLSVPQLPR
#> 2760               LLFVGFLSMVALTIVQGKGSHASPKR
#> 2761                     SVVALRIRNTSSRKVVLDPR
#> 2762                               KRIRKDFGKR
#> 2763                           DLKLPNDWAFKIIK
#> 2764                            YLVAREAMAKRSK
#> 2765                         RVSAPPAVRVGERQFR
#> 2766                         NLYLLGALSADITQSR
#> 2767                          EFSIVRNNGEKSILK
#> 2768                                   RIFLRK
#> 2769                               RTFSTLRLLR
#> 2770                             KEIRRRAMFLRR
#> 2771                              RNSTKQEDLVK
#> 2772                   GLEALLRPKSIAVLGASEKPGR
#> 2773                          LNRRYRLVKMGQRTR
#> 2774                                   KPWRQK
#> 2775                        LLLSVLQKYASNNFPLR
#> 2776                           LADSVILYLNAQIR
#> 2777                                 RLEFITRR
#> 2778                           QIDILLEQVAEKLR
#> 2779                       QGDMLENLITAVGPITIK
#> 2780                              RNEPEWMLEFR
#> 2781                                LNVWRILRR
#> 2782                              RNISFIKRLVR
#> 2783                                 RGYQRLAK
#> 2784                                RMRRDVNER
#> 2785                               HNKLKRLAER
#> 2786                                  RRSERLR
#> 2787                                 KTYIIQRR
#> 2788                       DLIRDYRLTGRARRLAIR
#> 2789                              RGIRQGHRKTK
#> 2790                         TKKPDSREAKPSRRRR
#> 2791                      GSGIEKIADLKGKRIGIFR
#> 2792                             VGFSTMRQALRR
#> 2793                              EKIEDYLSLRR
#> 2794                     LITLVAIVFKIKEEKHFPIK
#> 2795                                RFGKRFLMR
#> 2796                                 DNKIRFSR
#> 2797                            LPQKSLNALVLLR
#> 2798                           RAKRLQQEGNVLVR
#> 2799                                  RWRLFPR
#> 2800                         RNKSYTKITWLIISDR
#> 2801                         PDDELAVAQREGTLHR
#> 2802                                RSRPRRPRK
#> 2803                                LNVWRILRR
#> 2804                    FRHRLFNGGMSGEVSREILER
#> 2805                         FLKKATELWDGKFPRK
#> 2806                            VKDLLKFLKAQTK
#> 2807                          KITTKALPDKTRSPR
#> 2808                         EGKKTVVVRIAEAGVR
#> 2809                         DQLTTLEALLQAGVVR
#> 2810                              RTKFRKVHKGR
#> 2811                          DLRDLKLFLHLAESR
#> 2812                           LLKDIRLQDVVNYR
#> 2813              KLNLAQGHARLTAFAARQLNDRTLAQR
#> 2814                          AGMHRHTDGETGVGR
#> 2815                             IRKIFRAVRWAR
#> 2816                                RVILPQALR
#> 2817                                RTYKALSNR
#> 2818                             RGDRIAFVSGLR
#> 2819                    YRTLWQEDDQLPYTEGAREGR
#> 2820                  QTADALKTTVIGLQETEFGDVGR
#> 2821                               RYKEMNERRR
#> 2822                                 RSFRVQTK
#> 2823                             IDLRLPLTDIHR
#> 2824                         ALSAIRDSVREEKRQR
#> 2825                           VMLRQEKRRVSFHR
#> 2826                             RGYVMQGHDLNR
#> 2827                                  HELTIRR
#> 2828                              RLQRQRNAALR
#> 2829                  TGSLVIITFFIIHNIFYFFLNRK
#> 2830                                 RGLLNRLR
#> 2831                          DTLFSDVRLIIYNRR
#> 2832                            RGTKAVLDELAKR
#> 2833                                REQEFLKKR
#> 2834                            GVADKAEKSKVKR
#> 2835                             EKIIASLKGKMR
#> 2836                 KLEERSRAFAAYLQNQLKLQKGDR
#> 2837                  PQQFSDFGIHSPLSTALFNSELR
#> 2838                        EISKRRAAEQSAEQALR
#> 2839                         RKRRRATPKREAPHTK
#> 2840                                 KTPFLLKR
#> 2841                              RLQERQAALTR
#> 2842                      SARGALLQQHIIMGAEITK
#> 2843             LIDGLPEGTRDLEKQYFPFLHNFQPVNR
#> 2844                     QIRATAEQVISARRDATRSR
#> 2845                       RSWKTADKKPVKNVDLWK
#> 2846                                 RHLRRYPR
#> 2847                          AGTEVNLSWQPEHLR
#> 2848                    TVEVALVTGGGQGIGRAIALR
#> 2849                    EVSDSLVRRLQTGYVRMIGTR
#> 2850                             NPLWFLLRRGVR
#> 2851                             KVETLYRITLNR
#> 2852                             RGVRGKLFTLYR
#> 2853                 DIDHALDAAHKAKAEWGGLSVQER
#> 2854             ATGPDIVYRIGPVTLSTEAVNTALVIRR
#> 2855                              DILDREAPKIR
#> 2856                               RDNETLHRKR
#> 2857                                MDKVANEFR
#>                                         spectrumID chargeState rank
#> 1    controllerType=0 controllerNumber=1 scan=2949           3    1
#> 2    controllerType=0 controllerNumber=1 scan=6534           2    1
#> 3    controllerType=0 controllerNumber=1 scan=5674           2    1
#> 4    controllerType=0 controllerNumber=1 scan=4782           3    1
#> 5    controllerType=0 controllerNumber=1 scan=5839           3    1
#> 6    controllerType=0 controllerNumber=1 scan=6118           3    1
#> 7    controllerType=0 controllerNumber=1 scan=4757           2    1
#> 8    controllerType=0 controllerNumber=1 scan=6518           3    1
#> 9    controllerType=0 controllerNumber=1 scan=6518           3    1
#> 10   controllerType=0 controllerNumber=1 scan=6356           2    1
#> 11   controllerType=0 controllerNumber=1 scan=5805           4    1
#> 12   controllerType=0 controllerNumber=1 scan=2515           3    1
#> 13   controllerType=0 controllerNumber=1 scan=1496           2    1
#> 14   controllerType=0 controllerNumber=1 scan=4674           5    1
#> 15   controllerType=0 controllerNumber=1 scan=4921           4    1
#> 16   controllerType=0 controllerNumber=1 scan=4267           3    1
#> 17   controllerType=0 controllerNumber=1 scan=4310           4    1
#> 18   controllerType=0 controllerNumber=1 scan=3111           3    1
#> 19   controllerType=0 controllerNumber=1 scan=2892           2    1
#> 20   controllerType=0 controllerNumber=1 scan=5340           3    1
#> 21   controllerType=0 controllerNumber=1 scan=6690           4    1
#> 22   controllerType=0 controllerNumber=1 scan=6088           3    1
#> 23   controllerType=0 controllerNumber=1 scan=5490           3    1
#> 24   controllerType=0 controllerNumber=1 scan=5490           3    1
#> 25   controllerType=0 controllerNumber=1 scan=5490           3    1
#> 26   controllerType=0 controllerNumber=1 scan=5490           3    1
#> 27   controllerType=0 controllerNumber=1 scan=5342           3    1
#> 28   controllerType=0 controllerNumber=1 scan=6084           3    1
#> 29   controllerType=0 controllerNumber=1 scan=3975           2    1
#> 30   controllerType=0 controllerNumber=1 scan=6099           2    1
#> 31   controllerType=0 controllerNumber=1 scan=6099           2    1
#> 32   controllerType=0 controllerNumber=1 scan=6139           2    1
#> 33   controllerType=0 controllerNumber=1 scan=1093           2    1
#> 34   controllerType=0 controllerNumber=1 scan=5297           3    2
#> 35   controllerType=0 controllerNumber=1 scan=6520           2    1
#> 36   controllerType=0 controllerNumber=1 scan=3563           3    1
#> 37   controllerType=0 controllerNumber=1 scan=5250           4    1
#> 38   controllerType=0 controllerNumber=1 scan=4850           3    1
#> 39   controllerType=0 controllerNumber=1 scan=5692           2    1
#> 40   controllerType=0 controllerNumber=1 scan=5319           3    1
#> 41   controllerType=0 controllerNumber=1 scan=2703           3    1
#> 42   controllerType=0 controllerNumber=1 scan=2703           3    1
#> 43   controllerType=0 controllerNumber=1 scan=1391           2    1
#> 44   controllerType=0 controllerNumber=1 scan=5302           4    1
#> 45   controllerType=0 controllerNumber=1 scan=5302           4    1
#> 46   controllerType=0 controllerNumber=1 scan=6355           2    1
#> 47   controllerType=0 controllerNumber=1 scan=3462           2    1
#> 48   controllerType=0 controllerNumber=1 scan=2016           2    1
#> 49   controllerType=0 controllerNumber=1 scan=6175           4    1
#> 50   controllerType=0 controllerNumber=1 scan=4865           3    1
#> 51   controllerType=0 controllerNumber=1 scan=1172           2    1
#> 52   controllerType=0 controllerNumber=1 scan=4436           3    1
#> 53   controllerType=0 controllerNumber=1 scan=6292           2    1
#> 54   controllerType=0 controllerNumber=1 scan=6411           2    1
#> 55   controllerType=0 controllerNumber=1 scan=6523           3    1
#> 56   controllerType=0 controllerNumber=1 scan=5032           3    1
#> 57   controllerType=0 controllerNumber=1 scan=4800           3    1
#> 58   controllerType=0 controllerNumber=1 scan=6588           3    1
#> 59   controllerType=0 controllerNumber=1 scan=4793           2    1
#> 60   controllerType=0 controllerNumber=1 scan=3754           4    1
#> 61   controllerType=0 controllerNumber=1 scan=5068           2    1
#> 62   controllerType=0 controllerNumber=1 scan=6262           3    1
#> 63   controllerType=0 controllerNumber=1 scan=1955           2    1
#> 64   controllerType=0 controllerNumber=1 scan=6275           3    1
#> 65   controllerType=0 controllerNumber=1 scan=1154           4    1
#> 66   controllerType=0 controllerNumber=1 scan=5005           3    1
#> 67   controllerType=0 controllerNumber=1 scan=6391           3    1
#> 68   controllerType=0 controllerNumber=1 scan=5388           3    1
#> 69   controllerType=0 controllerNumber=1 scan=4030           2    1
#> 70   controllerType=0 controllerNumber=1 scan=4836           3    1
#> 71   controllerType=0 controllerNumber=1 scan=5268           2    1
#> 72   controllerType=0 controllerNumber=1 scan=5186           4    1
#> 73   controllerType=0 controllerNumber=1 scan=6145           4    1
#> 74   controllerType=0 controllerNumber=1 scan=6628           4    1
#> 75   controllerType=0 controllerNumber=1 scan=5338           3    1
#> 76   controllerType=0 controllerNumber=1 scan=4285           2    1
#> 77   controllerType=0 controllerNumber=1 scan=4285           2    1
#> 78   controllerType=0 controllerNumber=1 scan=4663           4    1
#> 79   controllerType=0 controllerNumber=1 scan=5970           2    1
#> 80   controllerType=0 controllerNumber=1 scan=6396           2    1
#> 81   controllerType=0 controllerNumber=1 scan=1981           2    1
#> 82   controllerType=0 controllerNumber=1 scan=3905           3    1
#> 83   controllerType=0 controllerNumber=1 scan=3905           3    1
#> 84   controllerType=0 controllerNumber=1 scan=1438           3    1
#> 85   controllerType=0 controllerNumber=1 scan=2233           2    1
#> 86   controllerType=0 controllerNumber=1 scan=4029           3    1
#> 87   controllerType=0 controllerNumber=1 scan=6691           3    1
#> 88   controllerType=0 controllerNumber=1 scan=6691           3    1
#> 89   controllerType=0 controllerNumber=1 scan=1073           5    1
#> 90   controllerType=0 controllerNumber=1 scan=1073           5    1
#> 91   controllerType=0 controllerNumber=1 scan=3963           3    1
#> 92   controllerType=0 controllerNumber=1 scan=5741           3    1
#> 93   controllerType=0 controllerNumber=1 scan=5203           2    1
#> 94   controllerType=0 controllerNumber=1 scan=4059           3    1
#> 95   controllerType=0 controllerNumber=1 scan=1129           2    1
#> 96   controllerType=0 controllerNumber=1 scan=5821           4    1
#> 97   controllerType=0 controllerNumber=1 scan=4343           3    1
#> 98   controllerType=0 controllerNumber=1 scan=5930           4    1
#> 99   controllerType=0 controllerNumber=1 scan=6194           4    1
#> 100  controllerType=0 controllerNumber=1 scan=1529           2    1
#> 101  controllerType=0 controllerNumber=1 scan=3979           3    1
#> 102  controllerType=0 controllerNumber=1 scan=2263           3    1
#> 103  controllerType=0 controllerNumber=1 scan=6269           4    1
#> 104  controllerType=0 controllerNumber=1 scan=3510           3    1
#> 105  controllerType=0 controllerNumber=1 scan=5628           3    1
#> 106  controllerType=0 controllerNumber=1 scan=4393           3    1
#> 107  controllerType=0 controllerNumber=1 scan=4393           3    1
#> 108  controllerType=0 controllerNumber=1 scan=5097           2    1
#> 109  controllerType=0 controllerNumber=1 scan=5583           3    1
#> 110  controllerType=0 controllerNumber=1 scan=5452           3    1
#> 111  controllerType=0 controllerNumber=1 scan=1831           3    1
#> 112  controllerType=0 controllerNumber=1 scan=1831           3    1
#> 113  controllerType=0 controllerNumber=1 scan=6278           4    1
#> 114  controllerType=0 controllerNumber=1 scan=5266           5    1
#> 115  controllerType=0 controllerNumber=1 scan=6604           4    1
#> 116  controllerType=0 controllerNumber=1 scan=5435           2    2
#> 117  controllerType=0 controllerNumber=1 scan=5665           3    1
#> 118  controllerType=0 controllerNumber=1 scan=5346           2    1
#> 119  controllerType=0 controllerNumber=1 scan=6210           2    1
#> 120  controllerType=0 controllerNumber=1 scan=5492           3    1
#> 121  controllerType=0 controllerNumber=1 scan=1840           2    1
#> 122  controllerType=0 controllerNumber=1 scan=4837           3    1
#> 123  controllerType=0 controllerNumber=1 scan=4922           3    1
#> 124  controllerType=0 controllerNumber=1 scan=4846           2    1
#> 125  controllerType=0 controllerNumber=1 scan=4894           3    1
#> 126  controllerType=0 controllerNumber=1 scan=3329           3    1
#> 127  controllerType=0 controllerNumber=1 scan=1303           2    1
#> 128  controllerType=0 controllerNumber=1 scan=4377           2    1
#> 129  controllerType=0 controllerNumber=1 scan=6123           4    1
#> 130  controllerType=0 controllerNumber=1 scan=5072           3    1
#> 131  controllerType=0 controllerNumber=1 scan=6017           3    1
#> 132  controllerType=0 controllerNumber=1 scan=4741           3    1
#> 133  controllerType=0 controllerNumber=1 scan=5526           4    1
#> 134  controllerType=0 controllerNumber=1 scan=3531           2    1
#> 135  controllerType=0 controllerNumber=1 scan=6483           3    1
#> 136  controllerType=0 controllerNumber=1 scan=1569           3    1
#> 137  controllerType=0 controllerNumber=1 scan=1569           3    1
#> 138  controllerType=0 controllerNumber=1 scan=6446           2    1
#> 139  controllerType=0 controllerNumber=1 scan=6191           3    1
#> 140  controllerType=0 controllerNumber=1 scan=4101           3    1
#> 141  controllerType=0 controllerNumber=1 scan=4101           3    1
#> 142  controllerType=0 controllerNumber=1 scan=3922           2    1
#> 143  controllerType=0 controllerNumber=1 scan=6705           3    1
#> 144  controllerType=0 controllerNumber=1 scan=5330           3    1
#> 145  controllerType=0 controllerNumber=1 scan=5330           3    1
#> 146  controllerType=0 controllerNumber=1 scan=6087           4    1
#> 147  controllerType=0 controllerNumber=1 scan=5196           3    1
#> 148  controllerType=0 controllerNumber=1 scan=3935           3    1
#> 149  controllerType=0 controllerNumber=1 scan=6516           3    1
#> 150  controllerType=0 controllerNumber=1 scan=4549           3    1
#> 151  controllerType=0 controllerNumber=1 scan=5237           4    1
#> 152  controllerType=0 controllerNumber=1 scan=5237           4    1
#> 153  controllerType=0 controllerNumber=1 scan=6522           4    2
#> 154  controllerType=0 controllerNumber=1 scan=5231           4    1
#> 155  controllerType=0 controllerNumber=1 scan=1692           2    1
#> 156  controllerType=0 controllerNumber=1 scan=5239           3    1
#> 157  controllerType=0 controllerNumber=1 scan=6094           3    1
#> 158  controllerType=0 controllerNumber=1 scan=4770           2    1
#> 159  controllerType=0 controllerNumber=1 scan=5207           2    1
#> 160  controllerType=0 controllerNumber=1 scan=1187           3    1
#> 161  controllerType=0 controllerNumber=1 scan=1226           4    1
#> 162  controllerType=0 controllerNumber=1 scan=4437           3    1
#> 163  controllerType=0 controllerNumber=1 scan=6692           3    1
#> 164  controllerType=0 controllerNumber=1 scan=1596           2    1
#> 165  controllerType=0 controllerNumber=1 scan=4363           3    1
#> 166  controllerType=0 controllerNumber=1 scan=4561           2    2
#> 167  controllerType=0 controllerNumber=1 scan=6180           4    1
#> 168  controllerType=0 controllerNumber=1 scan=1158           2    1
#> 169  controllerType=0 controllerNumber=1 scan=5619           3    1
#> 170  controllerType=0 controllerNumber=1 scan=2527           3    1
#> 171  controllerType=0 controllerNumber=1 scan=4934           3    1
#> 172  controllerType=0 controllerNumber=1 scan=4934           3    1
#> 173  controllerType=0 controllerNumber=1 scan=6747           3    1
#> 174  controllerType=0 controllerNumber=1 scan=5246           3    1
#> 175  controllerType=0 controllerNumber=1 scan=5551           3    1
#> 176  controllerType=0 controllerNumber=1 scan=6608           4    1
#> 177  controllerType=0 controllerNumber=1 scan=6608           4    1
#> 178  controllerType=0 controllerNumber=1 scan=4892           3    1
#> 179  controllerType=0 controllerNumber=1 scan=5173           3    1
#> 180  controllerType=0 controllerNumber=1 scan=1847           2    1
#> 181  controllerType=0 controllerNumber=1 scan=3356           2    1
#> 182  controllerType=0 controllerNumber=1 scan=4527           3    1
#> 183  controllerType=0 controllerNumber=1 scan=3617           2    1
#> 184  controllerType=0 controllerNumber=1 scan=4825           3    1
#> 185  controllerType=0 controllerNumber=1 scan=3774           3    1
#> 186  controllerType=0 controllerNumber=1 scan=6749           2    1
#> 187  controllerType=0 controllerNumber=1 scan=2035           3    1
#> 188  controllerType=0 controllerNumber=1 scan=5182           2    1
#> 189  controllerType=0 controllerNumber=1 scan=6574           4    1
#> 190  controllerType=0 controllerNumber=1 scan=1521           2    1
#> 191  controllerType=0 controllerNumber=1 scan=2255           2    1
#> 192  controllerType=0 controllerNumber=1 scan=5220           3    1
#> 193  controllerType=0 controllerNumber=1 scan=4163           3    1
#> 194  controllerType=0 controllerNumber=1 scan=5109           3    1
#> 195  controllerType=0 controllerNumber=1 scan=6553           2    2
#> 196  controllerType=0 controllerNumber=1 scan=2531           3    1
#> 197  controllerType=0 controllerNumber=1 scan=3270           3    1
#> 198  controllerType=0 controllerNumber=1 scan=5190           3    1
#> 199  controllerType=0 controllerNumber=1 scan=5625           3    1
#> 200  controllerType=0 controllerNumber=1 scan=4640           2    1
#> 201  controllerType=0 controllerNumber=1 scan=6578           3    1
#> 202  controllerType=0 controllerNumber=1 scan=6578           3    1
#> 203  controllerType=0 controllerNumber=1 scan=4573           2    1
#> 204  controllerType=0 controllerNumber=1 scan=5308           3    1
#> 205  controllerType=0 controllerNumber=1 scan=5591           4    1
#> 206  controllerType=0 controllerNumber=1 scan=6572           4    1
#> 207  controllerType=0 controllerNumber=1 scan=5360           3    1
#> 208  controllerType=0 controllerNumber=1 scan=5497           3    1
#> 209  controllerType=0 controllerNumber=1 scan=5187           3    1
#> 210  controllerType=0 controllerNumber=1 scan=3153           2    1
#> 211  controllerType=0 controllerNumber=1 scan=6585           3    1
#> 212  controllerType=0 controllerNumber=1 scan=6149           2    1
#> 213  controllerType=0 controllerNumber=1 scan=5444           2    1
#> 214  controllerType=0 controllerNumber=1 scan=4207           2    1
#> 215  controllerType=0 controllerNumber=1 scan=5814           4    1
#> 216  controllerType=0 controllerNumber=1 scan=5814           4    1
#> 217  controllerType=0 controllerNumber=1 scan=5413           2    1
#> 218  controllerType=0 controllerNumber=1 scan=5420           3    1
#> 219  controllerType=0 controllerNumber=1 scan=3151           2    1
#> 220  controllerType=0 controllerNumber=1 scan=5484           3    1
#> 221  controllerType=0 controllerNumber=1 scan=2384           2    1
#> 222  controllerType=0 controllerNumber=1 scan=6147           3    1
#> 223  controllerType=0 controllerNumber=1 scan=5891           4    1
#> 224  controllerType=0 controllerNumber=1 scan=5705           2    1
#> 225  controllerType=0 controllerNumber=1 scan=5705           2    2
#> 226  controllerType=0 controllerNumber=1 scan=6372           3    1
#> 227  controllerType=0 controllerNumber=1 scan=4751           3    1
#> 228  controllerType=0 controllerNumber=1 scan=4751           3    1
#> 229  controllerType=0 controllerNumber=1 scan=5063           3    1
#> 230  controllerType=0 controllerNumber=1 scan=6347           2    1
#> 231  controllerType=0 controllerNumber=1 scan=6714           3    1
#> 232  controllerType=0 controllerNumber=1 scan=3913           3    1
#> 233  controllerType=0 controllerNumber=1 scan=6573           3    1
#> 234  controllerType=0 controllerNumber=1 scan=5948           3    1
#> 235  controllerType=0 controllerNumber=1 scan=1233           3    1
#> 236  controllerType=0 controllerNumber=1 scan=6622           3    1
#> 237  controllerType=0 controllerNumber=1 scan=5521           3    1
#> 238  controllerType=0 controllerNumber=1 scan=5717           2    1
#> 239  controllerType=0 controllerNumber=1 scan=5387           3    2
#> 240  controllerType=0 controllerNumber=1 scan=4145           4    1
#> 241  controllerType=0 controllerNumber=1 scan=5577           2    1
#> 242  controllerType=0 controllerNumber=1 scan=5255           3    1
#> 243  controllerType=0 controllerNumber=1 scan=6072           4    1
#> 244  controllerType=0 controllerNumber=1 scan=5006           3    1
#> 245  controllerType=0 controllerNumber=1 scan=3444           2    1
#> 246  controllerType=0 controllerNumber=1 scan=3166           3    1
#> 247  controllerType=0 controllerNumber=1 scan=3660           4    1
#> 248  controllerType=0 controllerNumber=1 scan=3660           4    1
#> 249  controllerType=0 controllerNumber=1 scan=4571           3    1
#> 250  controllerType=0 controllerNumber=1 scan=5900           3    1
#> 251  controllerType=0 controllerNumber=1 scan=5809           3    1
#> 252  controllerType=0 controllerNumber=1 scan=6341           3    1
#> 253  controllerType=0 controllerNumber=1 scan=6341           3    1
#> 254  controllerType=0 controllerNumber=1 scan=6066           3    1
#> 255  controllerType=0 controllerNumber=1 scan=1306           2    1
#> 256  controllerType=0 controllerNumber=1 scan=1506           2    1
#> 257  controllerType=0 controllerNumber=1 scan=5902           3    1
#> 258  controllerType=0 controllerNumber=1 scan=6085           2    1
#> 259  controllerType=0 controllerNumber=1 scan=5603           4    1
#> 260  controllerType=0 controllerNumber=1 scan=5148           3    1
#> 261  controllerType=0 controllerNumber=1 scan=6624           3    1
#> 262  controllerType=0 controllerNumber=1 scan=5697           3    1
#> 263  controllerType=0 controllerNumber=1 scan=5697           3    1
#> 264  controllerType=0 controllerNumber=1 scan=4480           3    1
#> 265  controllerType=0 controllerNumber=1 scan=3123           3    1
#> 266  controllerType=0 controllerNumber=1 scan=5224           3    1
#> 267  controllerType=0 controllerNumber=1 scan=5224           3    1
#> 268  controllerType=0 controllerNumber=1 scan=2534           3    1
#> 269  controllerType=0 controllerNumber=1 scan=4260           3    1
#> 270  controllerType=0 controllerNumber=1 scan=6651           2    1
#> 271  controllerType=0 controllerNumber=1 scan=4385           2    1
#> 272  controllerType=0 controllerNumber=1 scan=6064           2    1
#> 273  controllerType=0 controllerNumber=1 scan=3685           3    1
#> 274  controllerType=0 controllerNumber=1 scan=5019           2    1
#> 275  controllerType=0 controllerNumber=1 scan=4118           3    1
#> 276  controllerType=0 controllerNumber=1 scan=7222           3    1
#> 277  controllerType=0 controllerNumber=1 scan=4478           2    1
#> 278  controllerType=0 controllerNumber=1 scan=4478           2    1
#> 279  controllerType=0 controllerNumber=1 scan=4478           2    1
#> 280  controllerType=0 controllerNumber=1 scan=6603           3    1
#> 281  controllerType=0 controllerNumber=1 scan=6515           4    1
#> 282  controllerType=0 controllerNumber=1 scan=6332           3    1
#> 283  controllerType=0 controllerNumber=1 scan=6332           3    2
#> 284  controllerType=0 controllerNumber=1 scan=4091           3    1
#> 285  controllerType=0 controllerNumber=1 scan=6611           2    2
#> 286  controllerType=0 controllerNumber=1 scan=5055           3    1
#> 287  controllerType=0 controllerNumber=1 scan=1305           3    1
#> 288  controllerType=0 controllerNumber=1 scan=4918           3    1
#> 289  controllerType=0 controllerNumber=1 scan=4250           2    1
#> 290  controllerType=0 controllerNumber=1 scan=6308           2    1
#> 291  controllerType=0 controllerNumber=1 scan=4654           2    1
#> 292  controllerType=0 controllerNumber=1 scan=1237           2    1
#> 293  controllerType=0 controllerNumber=1 scan=3432           3    1
#> 294  controllerType=0 controllerNumber=1 scan=4720           2    1
#> 295  controllerType=0 controllerNumber=1 scan=5585           2    1
#> 296  controllerType=0 controllerNumber=1 scan=3168           2    1
#> 297  controllerType=0 controllerNumber=1 scan=4667           2    1
#> 298  controllerType=0 controllerNumber=1 scan=1326           2    1
#> 299  controllerType=0 controllerNumber=1 scan=2626           2    1
#> 300  controllerType=0 controllerNumber=1 scan=5538           3    1
#> 301  controllerType=0 controllerNumber=1 scan=5296           3    1
#> 302  controllerType=0 controllerNumber=1 scan=5296           3    2
#> 303  controllerType=0 controllerNumber=1 scan=6717           3    1
#> 304  controllerType=0 controllerNumber=1 scan=5771           2    1
#> 305  controllerType=0 controllerNumber=1 scan=1747           2    1
#> 306  controllerType=0 controllerNumber=1 scan=4923           3    1
#> 307  controllerType=0 controllerNumber=1 scan=4387           3    1
#> 308  controllerType=0 controllerNumber=1 scan=6512           2    1
#> 309  controllerType=0 controllerNumber=1 scan=4306           2    1
#> 310  controllerType=0 controllerNumber=1 scan=4614           3    1
#> 311  controllerType=0 controllerNumber=1 scan=4614           3    1
#> 312  controllerType=0 controllerNumber=1 scan=5990           3    1
#> 313   controllerType=0 controllerNumber=1 scan=993           3    1
#> 314  controllerType=0 controllerNumber=1 scan=3717           3    1
#> 315  controllerType=0 controllerNumber=1 scan=5135           3    1
#> 316  controllerType=0 controllerNumber=1 scan=5718           3    1
#> 317  controllerType=0 controllerNumber=1 scan=5192           3    1
#> 318  controllerType=0 controllerNumber=1 scan=4625           3    1
#> 319  controllerType=0 controllerNumber=1 scan=5391           3    2
#> 320  controllerType=0 controllerNumber=1 scan=5540           4    1
#> 321  controllerType=0 controllerNumber=1 scan=6140           2    1
#> 322  controllerType=0 controllerNumber=1 scan=5537           3    1
#> 323  controllerType=0 controllerNumber=1 scan=3351           3    1
#> 324  controllerType=0 controllerNumber=1 scan=5978           3    1
#> 325  controllerType=0 controllerNumber=1 scan=5012           3    1
#> 326  controllerType=0 controllerNumber=1 scan=1805           2    1
#> 327  controllerType=0 controllerNumber=1 scan=4927           3    1
#> 328  controllerType=0 controllerNumber=1 scan=1308           2    1
#> 329  controllerType=0 controllerNumber=1 scan=3491           3    1
#> 330  controllerType=0 controllerNumber=1 scan=5737           5    1
#> 331  controllerType=0 controllerNumber=1 scan=5509           3    1
#> 332  controllerType=0 controllerNumber=1 scan=5509           3    1
#> 333  controllerType=0 controllerNumber=1 scan=1550           2    1
#> 334  controllerType=0 controllerNumber=1 scan=6279           4    2
#> 335  controllerType=0 controllerNumber=1 scan=5703           2    1
#> 336  controllerType=0 controllerNumber=1 scan=5703           2    1
#> 337  controllerType=0 controllerNumber=1 scan=4286           4    1
#> 338  controllerType=0 controllerNumber=1 scan=1998           2    1
#> 339  controllerType=0 controllerNumber=1 scan=1074           2    1
#> 340  controllerType=0 controllerNumber=1 scan=1074           2    1
#> 341  controllerType=0 controllerNumber=1 scan=4933           4    1
#> 342  controllerType=0 controllerNumber=1 scan=2733           2    1
#> 343  controllerType=0 controllerNumber=1 scan=4813           3    2
#> 344  controllerType=0 controllerNumber=1 scan=5087           2    1
#> 345  controllerType=0 controllerNumber=1 scan=4121           3    2
#> 346  controllerType=0 controllerNumber=1 scan=5672           3    1
#> 347  controllerType=0 controllerNumber=1 scan=2769           2    1
#> 348  controllerType=0 controllerNumber=1 scan=3529           3    1
#> 349  controllerType=0 controllerNumber=1 scan=3529           3    1
#> 350  controllerType=0 controllerNumber=1 scan=6504           3    1
#> 351  controllerType=0 controllerNumber=1 scan=3952           2    2
#> 352  controllerType=0 controllerNumber=1 scan=6598           2    1
#> 353  controllerType=0 controllerNumber=1 scan=2997           2    1
#> 354  controllerType=0 controllerNumber=1 scan=4632           3    1
#> 355  controllerType=0 controllerNumber=1 scan=3967           2    1
#> 356  controllerType=0 controllerNumber=1 scan=3149           3    1
#> 357  controllerType=0 controllerNumber=1 scan=5416           3    1
#> 358  controllerType=0 controllerNumber=1 scan=5374           4    1
#> 359  controllerType=0 controllerNumber=1 scan=5049           3    1
#> 360  controllerType=0 controllerNumber=1 scan=3481           4    1
#> 361  controllerType=0 controllerNumber=1 scan=4507           3    1
#> 362  controllerType=0 controllerNumber=1 scan=6224           3    1
#> 363  controllerType=0 controllerNumber=1 scan=4701           2    1
#> 364  controllerType=0 controllerNumber=1 scan=1826           2    1
#> 365  controllerType=0 controllerNumber=1 scan=5750           3    1
#> 366  controllerType=0 controllerNumber=1 scan=5750           3    1
#> 367  controllerType=0 controllerNumber=1 scan=4810           3    1
#> 368  controllerType=0 controllerNumber=1 scan=7224           2    1
#> 369  controllerType=0 controllerNumber=1 scan=6007           2    1
#> 370  controllerType=0 controllerNumber=1 scan=1160           2    1
#> 371  controllerType=0 controllerNumber=1 scan=4349           4    1
#> 372  controllerType=0 controllerNumber=1 scan=3613           3    1
#> 373  controllerType=0 controllerNumber=1 scan=6506           5    2
#> 374  controllerType=0 controllerNumber=1 scan=5352           3    1
#> 375  controllerType=0 controllerNumber=1 scan=5352           3    1
#> 376  controllerType=0 controllerNumber=1 scan=5352           3    1
#> 377  controllerType=0 controllerNumber=1 scan=6373           4    1
#> 378  controllerType=0 controllerNumber=1 scan=2591           3    1
#> 379  controllerType=0 controllerNumber=1 scan=2194           2    1
#> 380  controllerType=0 controllerNumber=1 scan=5472           3    2
#> 381  controllerType=0 controllerNumber=1 scan=4931           4    2
#> 382  controllerType=0 controllerNumber=1 scan=4931           4    3
#> 383  controllerType=0 controllerNumber=1 scan=5638           3    1
#> 384  controllerType=0 controllerNumber=1 scan=5638           3    1
#> 385  controllerType=0 controllerNumber=1 scan=5638           3    1
#> 386  controllerType=0 controllerNumber=1 scan=5638           3    1
#> 387  controllerType=0 controllerNumber=1 scan=4491           3    1
#> 388  controllerType=0 controllerNumber=1 scan=5904           2    1
#> 389  controllerType=0 controllerNumber=1 scan=5904           2    2
#> 390  controllerType=0 controllerNumber=1 scan=5404           3    1
#> 391  controllerType=0 controllerNumber=1 scan=4746           2    1
#> 392  controllerType=0 controllerNumber=1 scan=2558           2    1
#> 393  controllerType=0 controllerNumber=1 scan=5366           2    1
#> 394  controllerType=0 controllerNumber=1 scan=5366           2    1
#> 395  controllerType=0 controllerNumber=1 scan=5366           2    1
#> 396  controllerType=0 controllerNumber=1 scan=1111           2    1
#> 397  controllerType=0 controllerNumber=1 scan=5724           2    1
#> 398  controllerType=0 controllerNumber=1 scan=3608           2    1
#> 399  controllerType=0 controllerNumber=1 scan=5913           3    1
#> 400  controllerType=0 controllerNumber=1 scan=5913           3    1
#> 401  controllerType=0 controllerNumber=1 scan=1150           3    2
#> 402  controllerType=0 controllerNumber=1 scan=6336           3    1
#> 403  controllerType=0 controllerNumber=1 scan=3248           3    1
#> 404  controllerType=0 controllerNumber=1 scan=6183           2    1
#> 405  controllerType=0 controllerNumber=1 scan=6727           3    2
#> 406  controllerType=0 controllerNumber=1 scan=6503           4    1
#> 407  controllerType=0 controllerNumber=1 scan=5561           2    1
#> 408  controllerType=0 controllerNumber=1 scan=5565           3    1
#> 409  controllerType=0 controllerNumber=1 scan=5617           5    1
#> 410  controllerType=0 controllerNumber=1 scan=5617           5    1
#> 411  controllerType=0 controllerNumber=1 scan=4936           5    1
#> 412  controllerType=0 controllerNumber=1 scan=4936           5    1
#> 413  controllerType=0 controllerNumber=1 scan=3611           2    1
#> 414  controllerType=0 controllerNumber=1 scan=3690           3    1
#> 415  controllerType=0 controllerNumber=1 scan=3520           3    2
#> 416  controllerType=0 controllerNumber=1 scan=5082           5    1
#> 417  controllerType=0 controllerNumber=1 scan=5790           2    1
#> 418  controllerType=0 controllerNumber=1 scan=5790           2    1
#> 419  controllerType=0 controllerNumber=1 scan=6600           2    1
#> 420  controllerType=0 controllerNumber=1 scan=5794           2    1
#> 421  controllerType=0 controllerNumber=1 scan=4950           2    1
#> 422  controllerType=0 controllerNumber=1 scan=4950           2    1
#> 423  controllerType=0 controllerNumber=1 scan=5267           3    1
#> 424  controllerType=0 controllerNumber=1 scan=5253           2    1
#> 425  controllerType=0 controllerNumber=1 scan=5782           3    1
#> 426  controllerType=0 controllerNumber=1 scan=6037           3    1
#> 427  controllerType=0 controllerNumber=1 scan=5235           3    1
#> 428  controllerType=0 controllerNumber=1 scan=5397           3    1
#> 429  controllerType=0 controllerNumber=1 scan=6075           3    1
#> 430  controllerType=0 controllerNumber=1 scan=5761           2    1
#> 431  controllerType=0 controllerNumber=1 scan=5449           3    1
#> 432  controllerType=0 controllerNumber=1 scan=3614           2    1
#> 433  controllerType=0 controllerNumber=1 scan=5442           2    1
#> 434  controllerType=0 controllerNumber=1 scan=3483           2    1
#> 435  controllerType=0 controllerNumber=1 scan=4965           2    1
#> 436  controllerType=0 controllerNumber=1 scan=6047           2    1
#> 437  controllerType=0 controllerNumber=1 scan=2844           2    1
#> 438  controllerType=0 controllerNumber=1 scan=5759           3    1
#> 439   controllerType=0 controllerNumber=1 scan=983           3    1
#> 440  controllerType=0 controllerNumber=1 scan=4112           2    1
#> 441  controllerType=0 controllerNumber=1 scan=1892           2    1
#> 442  controllerType=0 controllerNumber=1 scan=3686           2    1
#> 443   controllerType=0 controllerNumber=1 scan=986           2    1
#> 444  controllerType=0 controllerNumber=1 scan=5230           4    1
#> 445  controllerType=0 controllerNumber=1 scan=3926           3    1
#> 446  controllerType=0 controllerNumber=1 scan=3926           3    1
#> 447  controllerType=0 controllerNumber=1 scan=4756           2    1
#> 448  controllerType=0 controllerNumber=1 scan=5922           3    1
#> 449  controllerType=0 controllerNumber=1 scan=4784           2    1
#> 450  controllerType=0 controllerNumber=1 scan=4784           2    1
#> 451  controllerType=0 controllerNumber=1 scan=1169           3    1
#> 452  controllerType=0 controllerNumber=1 scan=2577           2    1
#> 453  controllerType=0 controllerNumber=1 scan=3591           2    1
#> 454  controllerType=0 controllerNumber=1 scan=2020           2    1
#> 455  controllerType=0 controllerNumber=1 scan=4251           2    1
#> 456  controllerType=0 controllerNumber=1 scan=3757           3    1
#> 457  controllerType=0 controllerNumber=1 scan=4521           2    1
#> 458  controllerType=0 controllerNumber=1 scan=2001           2    1
#> 459  controllerType=0 controllerNumber=1 scan=3827           2    1
#> 460  controllerType=0 controllerNumber=1 scan=5443           2    1
#> 461  controllerType=0 controllerNumber=1 scan=2151           2    1
#> 462  controllerType=0 controllerNumber=1 scan=2366           2    1
#> 463  controllerType=0 controllerNumber=1 scan=3938           2    1
#> 464  controllerType=0 controllerNumber=1 scan=5067           3    1
#> 465  controllerType=0 controllerNumber=1 scan=4697           2    1
#> 466  controllerType=0 controllerNumber=1 scan=6377           4    1
#> 467  controllerType=0 controllerNumber=1 scan=5516           3    1
#> 468  controllerType=0 controllerNumber=1 scan=4583           2    1
#> 469  controllerType=0 controllerNumber=1 scan=4109           3    1
#> 470  controllerType=0 controllerNumber=1 scan=7227           2    1
#> 471  controllerType=0 controllerNumber=1 scan=6346           4    1
#> 472  controllerType=0 controllerNumber=1 scan=2423           2    1
#> 473  controllerType=0 controllerNumber=1 scan=4162           2    1
#> 474  controllerType=0 controllerNumber=1 scan=6556           3    1
#> 475  controllerType=0 controllerNumber=1 scan=6497           4    1
#> 476  controllerType=0 controllerNumber=1 scan=4519           2    1
#> 477  controllerType=0 controllerNumber=1 scan=2919           2    1
#> 478  controllerType=0 controllerNumber=1 scan=7235           2    1
#> 479  controllerType=0 controllerNumber=1 scan=5528           2    1
#> 480  controllerType=0 controllerNumber=1 scan=2324           2    1
#> 481  controllerType=0 controllerNumber=1 scan=6156           3    1
#> 482  controllerType=0 controllerNumber=1 scan=4745           3    1
#> 483  controllerType=0 controllerNumber=1 scan=1066           3    1
#> 484  controllerType=0 controllerNumber=1 scan=4198           2    1
#> 485  controllerType=0 controllerNumber=1 scan=2022           2    1
#> 486  controllerType=0 controllerNumber=1 scan=3954           3    1
#> 487  controllerType=0 controllerNumber=1 scan=1411           2    1
#> 488  controllerType=0 controllerNumber=1 scan=1551           2    1
#> 489  controllerType=0 controllerNumber=1 scan=4829           3    1
#> 490  controllerType=0 controllerNumber=1 scan=7293           2    1
#> 491  controllerType=0 controllerNumber=1 scan=1503           3    1
#> 492  controllerType=0 controllerNumber=1 scan=3864           2    1
#> 493  controllerType=0 controllerNumber=1 scan=6492           3    1
#> 494  controllerType=0 controllerNumber=1 scan=5262           3    1
#> 495  controllerType=0 controllerNumber=1 scan=3059           2    1
#> 496  controllerType=0 controllerNumber=1 scan=3059           2    2
#> 497  controllerType=0 controllerNumber=1 scan=6214           4    1
#> 498  controllerType=0 controllerNumber=1 scan=6337           2    1
#> 499  controllerType=0 controllerNumber=1 scan=3118           3    1
#> 500  controllerType=0 controllerNumber=1 scan=1230           3    1
#> 501  controllerType=0 controllerNumber=1 scan=4794           3    1
#> 502  controllerType=0 controllerNumber=1 scan=4794           3    1
#> 503  controllerType=0 controllerNumber=1 scan=1660           4    1
#> 504  controllerType=0 controllerNumber=1 scan=4126           2    1
#> 505  controllerType=0 controllerNumber=1 scan=5952           3    1
#> 506  controllerType=0 controllerNumber=1 scan=3872           3    1
#> 507  controllerType=0 controllerNumber=1 scan=2624           4    1
#> 508  controllerType=0 controllerNumber=1 scan=6274           2    1
#> 509  controllerType=0 controllerNumber=1 scan=3567           4    1
#> 510  controllerType=0 controllerNumber=1 scan=5879           2    1
#> 511  controllerType=0 controllerNumber=1 scan=7260           3    1
#> 512  controllerType=0 controllerNumber=1 scan=3286           2    1
#> 513  controllerType=0 controllerNumber=1 scan=4475           4    1
#> 514  controllerType=0 controllerNumber=1 scan=5655           3    1
#> 515  controllerType=0 controllerNumber=1 scan=6709           2    1
#> 516  controllerType=0 controllerNumber=1 scan=2459           2    1
#> 517  controllerType=0 controllerNumber=1 scan=1025           3    1
#> 518  controllerType=0 controllerNumber=1 scan=4396           3    1
#> 519  controllerType=0 controllerNumber=1 scan=2956           2    1
#> 520  controllerType=0 controllerNumber=1 scan=2869           2    1
#> 521  controllerType=0 controllerNumber=1 scan=2078           2    1
#> 522  controllerType=0 controllerNumber=1 scan=4338           3    1
#> 523  controllerType=0 controllerNumber=1 scan=5045           3    1
#> 524  controllerType=0 controllerNumber=1 scan=1972           2    1
#> 525  controllerType=0 controllerNumber=1 scan=2420           6    1
#> 526  controllerType=0 controllerNumber=1 scan=4695           3    1
#> 527  controllerType=0 controllerNumber=1 scan=5464           3    1
#> 528   controllerType=0 controllerNumber=1 scan=948           3    1
#> 529  controllerType=0 controllerNumber=1 scan=5467           2    1
#> 530  controllerType=0 controllerNumber=1 scan=5527           3    1
#> 531  controllerType=0 controllerNumber=1 scan=3369           3    1
#> 532  controllerType=0 controllerNumber=1 scan=3080           3    1
#> 533  controllerType=0 controllerNumber=1 scan=3834           3    1
#> 534  controllerType=0 controllerNumber=1 scan=6079           4    1
#> 535  controllerType=0 controllerNumber=1 scan=1487           2    1
#> 536  controllerType=0 controllerNumber=1 scan=3055           3    1
#> 537  controllerType=0 controllerNumber=1 scan=5048           3    1
#> 538  controllerType=0 controllerNumber=1 scan=5048           3    1
#> 539  controllerType=0 controllerNumber=1 scan=4559           3    1
#> 540  controllerType=0 controllerNumber=1 scan=4574           3    1
#> 541  controllerType=0 controllerNumber=1 scan=4811           4    1
#> 542  controllerType=0 controllerNumber=1 scan=5358           2    1
#> 543  controllerType=0 controllerNumber=1 scan=1090           2    1
#> 544  controllerType=0 controllerNumber=1 scan=5099           3    1
#> 545  controllerType=0 controllerNumber=1 scan=4205           3    1
#> 546  controllerType=0 controllerNumber=1 scan=6006           3    1
#> 547  controllerType=0 controllerNumber=1 scan=4014           2    1
#> 548  controllerType=0 controllerNumber=1 scan=5052           3    1
#> 549  controllerType=0 controllerNumber=1 scan=6203           4    1
#> 550  controllerType=0 controllerNumber=1 scan=2068           3    1
#> 551  controllerType=0 controllerNumber=1 scan=5460           2    1
#> 552  controllerType=0 controllerNumber=1 scan=2419           2    1
#> 553  controllerType=0 controllerNumber=1 scan=2220           2    1
#> 554  controllerType=0 controllerNumber=1 scan=1554           2    1
#> 555  controllerType=0 controllerNumber=1 scan=3475           2    1
#> 556  controllerType=0 controllerNumber=1 scan=2639           2    1
#> 557  controllerType=0 controllerNumber=1 scan=2265           2    1
#> 558  controllerType=0 controllerNumber=1 scan=1348           2    1
#> 559  controllerType=0 controllerNumber=1 scan=5503           3    1
#> 560  controllerType=0 controllerNumber=1 scan=1398           2    1
#> 561  controllerType=0 controllerNumber=1 scan=1082           3    1
#> 562  controllerType=0 controllerNumber=1 scan=4596           3    1
#> 563  controllerType=0 controllerNumber=1 scan=5621           2    1
#> 564  controllerType=0 controllerNumber=1 scan=1027           3    1
#> 565  controllerType=0 controllerNumber=1 scan=5123           3    1
#> 566  controllerType=0 controllerNumber=1 scan=4007           4    1
#> 567  controllerType=0 controllerNumber=1 scan=5596           4    1
#> 568  controllerType=0 controllerNumber=1 scan=6166           3    1
#> 569  controllerType=0 controllerNumber=1 scan=4759           2    1
#> 570  controllerType=0 controllerNumber=1 scan=5709           3    1
#> 571  controllerType=0 controllerNumber=1 scan=6664           2    1
#> 572  controllerType=0 controllerNumber=1 scan=5170           3    1
#> 573  controllerType=0 controllerNumber=1 scan=6030           3    1
#> 574  controllerType=0 controllerNumber=1 scan=3043           4    1
#> 575  controllerType=0 controllerNumber=1 scan=4605           2    1
#> 576  controllerType=0 controllerNumber=1 scan=2926           2    1
#> 577  controllerType=0 controllerNumber=1 scan=1410           3    1
#> 578  controllerType=0 controllerNumber=1 scan=2289           2    1
#> 579  controllerType=0 controllerNumber=1 scan=5047           3    1
#> 580  controllerType=0 controllerNumber=1 scan=3916           3    1
#> 581  controllerType=0 controllerNumber=1 scan=6415           3    1
#> 582  controllerType=0 controllerNumber=1 scan=3342           3    1
#> 583  controllerType=0 controllerNumber=1 scan=5039           3    1
#> 584  controllerType=0 controllerNumber=1 scan=5576           3    1
#> 585  controllerType=0 controllerNumber=1 scan=4130           2    1
#> 586  controllerType=0 controllerNumber=1 scan=4531           3    1
#> 587  controllerType=0 controllerNumber=1 scan=2514           2    1
#> 588  controllerType=0 controllerNumber=1 scan=7192           2    1
#> 589  controllerType=0 controllerNumber=1 scan=3239           3    1
#> 590  controllerType=0 controllerNumber=1 scan=2986           2    1
#> 591  controllerType=0 controllerNumber=1 scan=3603           3    1
#> 592  controllerType=0 controllerNumber=1 scan=3352           2    1
#> 593  controllerType=0 controllerNumber=1 scan=5973           3    1
#> 594  controllerType=0 controllerNumber=1 scan=3965           3    1
#> 595  controllerType=0 controllerNumber=1 scan=2889           2    1
#> 596  controllerType=0 controllerNumber=1 scan=5365           2    1
#> 597  controllerType=0 controllerNumber=1 scan=6639           2    1
#> 598  controllerType=0 controllerNumber=1 scan=3943           3    1
#> 599  controllerType=0 controllerNumber=1 scan=5115           3    1
#> 600  controllerType=0 controllerNumber=1 scan=5677           2    1
#> 601  controllerType=0 controllerNumber=1 scan=4373           3    1
#> 602  controllerType=0 controllerNumber=1 scan=6320           3    1
#> 603  controllerType=0 controllerNumber=1 scan=6286           2    1
#> 604  controllerType=0 controllerNumber=1 scan=4212           2    1
#> 605  controllerType=0 controllerNumber=1 scan=7037           2    1
#> 606  controllerType=0 controllerNumber=1 scan=2201           3    1
#> 607  controllerType=0 controllerNumber=1 scan=5204           2    1
#> 608  controllerType=0 controllerNumber=1 scan=5666           4    1
#> 609  controllerType=0 controllerNumber=1 scan=2374           2    1
#> 610  controllerType=0 controllerNumber=1 scan=3759           3    1
#> 611  controllerType=0 controllerNumber=1 scan=6386           3    1
#> 612  controllerType=0 controllerNumber=1 scan=6111           3    1
#> 613  controllerType=0 controllerNumber=1 scan=1901           2    1
#> 614  controllerType=0 controllerNumber=1 scan=5335           3    1
#> 615  controllerType=0 controllerNumber=1 scan=3183           3    1
#> 616  controllerType=0 controllerNumber=1 scan=2487           2    1
#> 617  controllerType=0 controllerNumber=1 scan=3770           4    1
#> 618  controllerType=0 controllerNumber=1 scan=3906           2    1
#> 619  controllerType=0 controllerNumber=1 scan=3465           3    1
#> 620  controllerType=0 controllerNumber=1 scan=7084           3    1
#> 621  controllerType=0 controllerNumber=1 scan=6045           3    1
#> 622  controllerType=0 controllerNumber=1 scan=5188           4    1
#> 623  controllerType=0 controllerNumber=1 scan=2350           2    1
#> 624  controllerType=0 controllerNumber=1 scan=3639           2    1
#> 625  controllerType=0 controllerNumber=1 scan=2058           2    1
#> 626  controllerType=0 controllerNumber=1 scan=5367           4    1
#> 627  controllerType=0 controllerNumber=1 scan=2861           2    1
#> 628  controllerType=0 controllerNumber=1 scan=6392           2    1
#> 629  controllerType=0 controllerNumber=1 scan=1493           3    1
#> 630  controllerType=0 controllerNumber=1 scan=5953           2    1
#> 631  controllerType=0 controllerNumber=1 scan=5953           2    2
#> 632  controllerType=0 controllerNumber=1 scan=5336           3    1
#> 633  controllerType=0 controllerNumber=1 scan=2700           2    1
#> 634  controllerType=0 controllerNumber=1 scan=7085           3    1
#> 635  controllerType=0 controllerNumber=1 scan=1922           2    1
#> 636  controllerType=0 controllerNumber=1 scan=3914           3    1
#> 637  controllerType=0 controllerNumber=1 scan=2509           2    1
#> 638  controllerType=0 controllerNumber=1 scan=5555           2    1
#> 639  controllerType=0 controllerNumber=1 scan=4266           3    1
#> 640  controllerType=0 controllerNumber=1 scan=6246           2    1
#> 641   controllerType=0 controllerNumber=1 scan=951           3    1
#> 642  controllerType=0 controllerNumber=1 scan=3593           3    1
#> 643  controllerType=0 controllerNumber=1 scan=1051           2    1
#> 644  controllerType=0 controllerNumber=1 scan=5698           2    1
#> 645  controllerType=0 controllerNumber=1 scan=7165           2    1
#> 646  controllerType=0 controllerNumber=1 scan=6311           4    1
#> 647  controllerType=0 controllerNumber=1 scan=1743           2    1
#> 648  controllerType=0 controllerNumber=1 scan=1790           2    1
#> 649  controllerType=0 controllerNumber=1 scan=5477           3    1
#> 650  controllerType=0 controllerNumber=1 scan=2371           2    1
#> 651  controllerType=0 controllerNumber=1 scan=2841           2    1
#> 652  controllerType=0 controllerNumber=1 scan=5001           3    1
#> 653  controllerType=0 controllerNumber=1 scan=1318           2    1
#> 654  controllerType=0 controllerNumber=1 scan=3667           2    1
#> 655  controllerType=0 controllerNumber=1 scan=4796           2    1
#> 656  controllerType=0 controllerNumber=1 scan=4421           3    1
#> 657  controllerType=0 controllerNumber=1 scan=4884           3    1
#> 658  controllerType=0 controllerNumber=1 scan=4884           3    1
#> 659  controllerType=0 controllerNumber=1 scan=5258           3    1
#> 660  controllerType=0 controllerNumber=1 scan=1404           2    1
#> 661  controllerType=0 controllerNumber=1 scan=6063           3    1
#> 662  controllerType=0 controllerNumber=1 scan=4789           2    1
#> 663  controllerType=0 controllerNumber=1 scan=5797           2    1
#> 664  controllerType=0 controllerNumber=1 scan=5846           3    1
#> 665  controllerType=0 controllerNumber=1 scan=6234           3    1
#> 666  controllerType=0 controllerNumber=1 scan=4602           2    1
#> 667  controllerType=0 controllerNumber=1 scan=5668           4    1
#> 668  controllerType=0 controllerNumber=1 scan=5376           2    1
#> 669  controllerType=0 controllerNumber=1 scan=4562           4    1
#> 670  controllerType=0 controllerNumber=1 scan=5506           2    1
#> 671  controllerType=0 controllerNumber=1 scan=6543           3    1
#> 672  controllerType=0 controllerNumber=1 scan=6543           3    1
#> 673  controllerType=0 controllerNumber=1 scan=1589           3    1
#> 674  controllerType=0 controllerNumber=1 scan=5715           3    1
#> 675  controllerType=0 controllerNumber=1 scan=5609           2    1
#> 676  controllerType=0 controllerNumber=1 scan=3986           3    1
#> 677  controllerType=0 controllerNumber=1 scan=2359           2    1
#> 678  controllerType=0 controllerNumber=1 scan=6024           3    1
#> 679  controllerType=0 controllerNumber=1 scan=4214           3    1
#> 680  controllerType=0 controllerNumber=1 scan=4598           3    1
#> 681  controllerType=0 controllerNumber=1 scan=1476           2    1
#> 682  controllerType=0 controllerNumber=1 scan=2835           2    1
#> 683  controllerType=0 controllerNumber=1 scan=6661           2    1
#> 684  controllerType=0 controllerNumber=1 scan=4679           2    1
#> 685  controllerType=0 controllerNumber=1 scan=1825           2    1
#> 686  controllerType=0 controllerNumber=1 scan=4905           3    1
#> 687  controllerType=0 controllerNumber=1 scan=2394           3    1
#> 688  controllerType=0 controllerNumber=1 scan=5567           3    1
#> 689  controllerType=0 controllerNumber=1 scan=6198           3    1
#> 690  controllerType=0 controllerNumber=1 scan=2843           2    1
#> 691  controllerType=0 controllerNumber=1 scan=4403           2    1
#> 692  controllerType=0 controllerNumber=1 scan=2709           2    1
#> 693  controllerType=0 controllerNumber=1 scan=4805           3    1
#> 694  controllerType=0 controllerNumber=1 scan=6947           3    1
#> 695  controllerType=0 controllerNumber=1 scan=3116           2    1
#> 696  controllerType=0 controllerNumber=1 scan=4988           3    1
#> 697  controllerType=0 controllerNumber=1 scan=4994           2    1
#> 698  controllerType=0 controllerNumber=1 scan=1351           2    1
#> 699  controllerType=0 controllerNumber=1 scan=4615           3    1
#> 700  controllerType=0 controllerNumber=1 scan=1359           2    1
#> 701  controllerType=0 controllerNumber=1 scan=5961           2    1
#> 702  controllerType=0 controllerNumber=1 scan=4400           2    1
#> 703  controllerType=0 controllerNumber=1 scan=2175           2    1
#> 704  controllerType=0 controllerNumber=1 scan=5265           3    1
#> 705  controllerType=0 controllerNumber=1 scan=3091           2    1
#> 706  controllerType=0 controllerNumber=1 scan=4517           2    1
#> 707  controllerType=0 controllerNumber=1 scan=3264           3    1
#> 708  controllerType=0 controllerNumber=1 scan=6090           3    1
#> 709  controllerType=0 controllerNumber=1 scan=2129           3    1
#> 710  controllerType=0 controllerNumber=1 scan=5221           3    1
#> 711  controllerType=0 controllerNumber=1 scan=1759           2    1
#> 712  controllerType=0 controllerNumber=1 scan=1362           3    1
#> 713  controllerType=0 controllerNumber=1 scan=4199           2    1
#> 714  controllerType=0 controllerNumber=1 scan=3538           3    1
#> 715  controllerType=0 controllerNumber=1 scan=2806           3    1
#> 716  controllerType=0 controllerNumber=1 scan=6589           2    1
#> 717  controllerType=0 controllerNumber=1 scan=5510           3    1
#> 718  controllerType=0 controllerNumber=1 scan=1933           2    1
#> 719  controllerType=0 controllerNumber=1 scan=1408           2    1
#> 720  controllerType=0 controllerNumber=1 scan=6011           3    1
#> 721  controllerType=0 controllerNumber=1 scan=6673           2    1
#> 722  controllerType=0 controllerNumber=1 scan=6363           4    1
#> 723  controllerType=0 controllerNumber=1 scan=1477           3    1
#> 724  controllerType=0 controllerNumber=1 scan=4552           3    1
#> 725  controllerType=0 controllerNumber=1 scan=4552           3    2
#> 726  controllerType=0 controllerNumber=1 scan=6054           3    1
#> 727  controllerType=0 controllerNumber=1 scan=5938           2    1
#> 728  controllerType=0 controllerNumber=1 scan=4576           2    1
#> 729  controllerType=0 controllerNumber=1 scan=5898           3    1
#> 730  controllerType=0 controllerNumber=1 scan=3066           2    1
#> 731  controllerType=0 controllerNumber=1 scan=1497           2    1
#> 732  controllerType=0 controllerNumber=1 scan=6660           3    1
#> 733  controllerType=0 controllerNumber=1 scan=3063           4    1
#> 734  controllerType=0 controllerNumber=1 scan=2493           2    1
#> 735  controllerType=0 controllerNumber=1 scan=3699           2    1
#> 736  controllerType=0 controllerNumber=1 scan=6889           2    1
#> 737  controllerType=0 controllerNumber=1 scan=3146           3    1
#> 738  controllerType=0 controllerNumber=1 scan=3585           2    1
#> 739  controllerType=0 controllerNumber=1 scan=4311           3    1
#> 740  controllerType=0 controllerNumber=1 scan=2087           2    1
#> 741  controllerType=0 controllerNumber=1 scan=5942           3    1
#> 742  controllerType=0 controllerNumber=1 scan=3590           3    1
#> 743  controllerType=0 controllerNumber=1 scan=4834           3    1
#> 744  controllerType=0 controllerNumber=1 scan=5610           4    1
#> 745  controllerType=0 controllerNumber=1 scan=4498           2    1
#> 746  controllerType=0 controllerNumber=1 scan=3576           2    1
#> 747  controllerType=0 controllerNumber=1 scan=5714           4    1
#> 748  controllerType=0 controllerNumber=1 scan=2286           2    1
#> 749  controllerType=0 controllerNumber=1 scan=2546           2    1
#> 750  controllerType=0 controllerNumber=1 scan=4080           3    1
#> 751  controllerType=0 controllerNumber=1 scan=6105           4    1
#> 752  controllerType=0 controllerNumber=1 scan=2551           2    1
#> 753  controllerType=0 controllerNumber=1 scan=3466           3    1
#> 754  controllerType=0 controllerNumber=1 scan=2520           4    1
#> 755  controllerType=0 controllerNumber=1 scan=4572           3    1
#> 756  controllerType=0 controllerNumber=1 scan=2729           2    1
#> 757  controllerType=0 controllerNumber=1 scan=2311           3    1
#> 758  controllerType=0 controllerNumber=1 scan=6226           3    1
#> 759  controllerType=0 controllerNumber=1 scan=6680           3    1
#> 760  controllerType=0 controllerNumber=1 scan=5589           4    1
#> 761  controllerType=0 controllerNumber=1 scan=5688           3    1
#> 762  controllerType=0 controllerNumber=1 scan=4539           3    1
#> 763  controllerType=0 controllerNumber=1 scan=5189           3    1
#> 764  controllerType=0 controllerNumber=1 scan=2491           2    1
#> 765  controllerType=0 controllerNumber=1 scan=2044           2    1
#> 766  controllerType=0 controllerNumber=1 scan=5885           4    1
#> 767  controllerType=0 controllerNumber=1 scan=4438           2    1
#> 768  controllerType=0 controllerNumber=1 scan=6587           3    1
#> 769  controllerType=0 controllerNumber=1 scan=2618           3    1
#> 770  controllerType=0 controllerNumber=1 scan=3553           3    1
#> 771  controllerType=0 controllerNumber=1 scan=5570           3    1
#> 772  controllerType=0 controllerNumber=1 scan=3279           2    1
#> 773  controllerType=0 controllerNumber=1 scan=3747           3    1
#> 774  controllerType=0 controllerNumber=1 scan=6621           2    1
#> 775  controllerType=0 controllerNumber=1 scan=4989           3    1
#> 776  controllerType=0 controllerNumber=1 scan=1145           2    1
#> 777  controllerType=0 controllerNumber=1 scan=6470           4    1
#> 778  controllerType=0 controllerNumber=1 scan=3939           3    1
#> 779  controllerType=0 controllerNumber=1 scan=3089           2    1
#> 780  controllerType=0 controllerNumber=1 scan=6265           3    1
#> 781  controllerType=0 controllerNumber=1 scan=4748           2    1
#> 782  controllerType=0 controllerNumber=1 scan=3987           3    1
#> 783  controllerType=0 controllerNumber=1 scan=5822           3    1
#> 784  controllerType=0 controllerNumber=1 scan=6729           2    1
#> 785  controllerType=0 controllerNumber=1 scan=5300           4    1
#> 786  controllerType=0 controllerNumber=1 scan=6199           2    1
#> 787  controllerType=0 controllerNumber=1 scan=3111           3    2
#> 788  controllerType=0 controllerNumber=1 scan=4739           3    1
#> 789  controllerType=0 controllerNumber=1 scan=4935           2    1
#> 790  controllerType=0 controllerNumber=1 scan=1652           2    1
#> 791   controllerType=0 controllerNumber=1 scan=985           3    1
#> 792  controllerType=0 controllerNumber=1 scan=4819           2    1
#> 793  controllerType=0 controllerNumber=1 scan=5874           2    1
#> 794  controllerType=0 controllerNumber=1 scan=1740           2    1
#> 795  controllerType=0 controllerNumber=1 scan=6192           4    1
#> 796  controllerType=0 controllerNumber=1 scan=4035           2    1
#> 797  controllerType=0 controllerNumber=1 scan=5017           3    1
#> 798  controllerType=0 controllerNumber=1 scan=5154           2    1
#> 799  controllerType=0 controllerNumber=1 scan=3657           2    1
#> 800  controllerType=0 controllerNumber=1 scan=3420           2    1
#> 801  controllerType=0 controllerNumber=1 scan=3730           3    1
#> 802  controllerType=0 controllerNumber=1 scan=1425           2    1
#> 803  controllerType=0 controllerNumber=1 scan=3932           3    1
#> 804  controllerType=0 controllerNumber=1 scan=5552           3    1
#> 805  controllerType=0 controllerNumber=1 scan=5119           4    1
#> 806  controllerType=0 controllerNumber=1 scan=3994           3    1
#> 807  controllerType=0 controllerNumber=1 scan=2145           3    1
#> 808  controllerType=0 controllerNumber=1 scan=4940           2    1
#> 809  controllerType=0 controllerNumber=1 scan=5641           3    1
#> 810  controllerType=0 controllerNumber=1 scan=4511           2    1
#> 811  controllerType=0 controllerNumber=1 scan=3164           2    1
#> 812  controllerType=0 controllerNumber=1 scan=1979           2    1
#> 813  controllerType=0 controllerNumber=1 scan=4081           4    1
#> 814  controllerType=0 controllerNumber=1 scan=2773           3    1
#> 815  controllerType=0 controllerNumber=1 scan=4977           3    1
#> 816  controllerType=0 controllerNumber=1 scan=1541           2    1
#> 817  controllerType=0 controllerNumber=1 scan=6021           3    1
#> 818  controllerType=0 controllerNumber=1 scan=1510           2    1
#> 819  controllerType=0 controllerNumber=1 scan=5932           3    1
#> 820  controllerType=0 controllerNumber=1 scan=2475           5    1
#> 821  controllerType=0 controllerNumber=1 scan=3982           3    1
#> 822  controllerType=0 controllerNumber=1 scan=5327           4    1
#> 823  controllerType=0 controllerNumber=1 scan=4696           2    1
#> 824  controllerType=0 controllerNumber=1 scan=6367           3    1
#> 825  controllerType=0 controllerNumber=1 scan=6300           3    1
#> 826  controllerType=0 controllerNumber=1 scan=5592           2    1
#> 827  controllerType=0 controllerNumber=1 scan=1193           3    1
#> 828  controllerType=0 controllerNumber=1 scan=4102           4    1
#> 829  controllerType=0 controllerNumber=1 scan=5389           3    1
#> 830  controllerType=0 controllerNumber=1 scan=1259           2    1
#> 831  controllerType=0 controllerNumber=1 scan=5653           2    1
#> 832  controllerType=0 controllerNumber=1 scan=4509           3    1
#> 833  controllerType=0 controllerNumber=1 scan=4329           4    1
#> 834  controllerType=0 controllerNumber=1 scan=6420           3    1
#> 835  controllerType=0 controllerNumber=1 scan=5169           3    1
#> 836  controllerType=0 controllerNumber=1 scan=1776           2    1
#> 837  controllerType=0 controllerNumber=1 scan=2882           2    1
#> 838  controllerType=0 controllerNumber=1 scan=1189           2    1
#> 839  controllerType=0 controllerNumber=1 scan=5721           2    1
#> 840  controllerType=0 controllerNumber=1 scan=4013           3    1
#> 841  controllerType=0 controllerNumber=1 scan=6368           3    1
#> 842  controllerType=0 controllerNumber=1 scan=4159           2    1
#> 843  controllerType=0 controllerNumber=1 scan=2410           2    1
#> 844  controllerType=0 controllerNumber=1 scan=2922           2    1
#> 845  controllerType=0 controllerNumber=1 scan=1055           3    1
#> 846  controllerType=0 controllerNumber=1 scan=6960           2    1
#> 847  controllerType=0 controllerNumber=1 scan=6020           3    1
#> 848  controllerType=0 controllerNumber=1 scan=5988           3    1
#> 849  controllerType=0 controllerNumber=1 scan=6343           2    1
#> 850  controllerType=0 controllerNumber=1 scan=4972           3    1
#> 851  controllerType=0 controllerNumber=1 scan=6576           2    1
#> 852  controllerType=0 controllerNumber=1 scan=4456           2    1
#> 853  controllerType=0 controllerNumber=1 scan=4705           2    1
#> 854  controllerType=0 controllerNumber=1 scan=1549           2    1
#> 855  controllerType=0 controllerNumber=1 scan=3517           3    1
#> 856  controllerType=0 controllerNumber=1 scan=7299           2    1
#> 857  controllerType=0 controllerNumber=1 scan=1543           3    1
#> 858  controllerType=0 controllerNumber=1 scan=6564           3    1
#> 859  controllerType=0 controllerNumber=1 scan=2615           3    1
#> 860  controllerType=0 controllerNumber=1 scan=5225           3    1
#> 861  controllerType=0 controllerNumber=1 scan=4752           2    1
#> 862  controllerType=0 controllerNumber=1 scan=3924           3    1
#> 863  controllerType=0 controllerNumber=1 scan=1934           2    1
#> 864  controllerType=0 controllerNumber=1 scan=3788           2    1
#> 865  controllerType=0 controllerNumber=1 scan=5830           2    1
#> 866  controllerType=0 controllerNumber=1 scan=2784           3    1
#> 867  controllerType=0 controllerNumber=1 scan=6433           2    1
#> 868  controllerType=0 controllerNumber=1 scan=6131           3    1
#> 869  controllerType=0 controllerNumber=1 scan=4367           3    1
#> 870  controllerType=0 controllerNumber=1 scan=2478           2    1
#> 871  controllerType=0 controllerNumber=1 scan=5070           3    1
#> 872  controllerType=0 controllerNumber=1 scan=6478           2    1
#> 873  controllerType=0 controllerNumber=1 scan=7492           3    1
#> 874  controllerType=0 controllerNumber=1 scan=2735           2    1
#> 875  controllerType=0 controllerNumber=1 scan=5694           2    1
#> 876  controllerType=0 controllerNumber=1 scan=6408           3    1
#> 877  controllerType=0 controllerNumber=1 scan=5534           3    1
#> 878  controllerType=0 controllerNumber=1 scan=5058           2    1
#> 879  controllerType=0 controllerNumber=1 scan=1274           3    1
#> 880  controllerType=0 controllerNumber=1 scan=5478           3    1
#> 881  controllerType=0 controllerNumber=1 scan=3989           3    1
#> 882  controllerType=0 controllerNumber=1 scan=5642           3    1
#> 883  controllerType=0 controllerNumber=1 scan=2683           2    1
#> 884  controllerType=0 controllerNumber=1 scan=3823           3    1
#> 885  controllerType=0 controllerNumber=1 scan=1628           3    1
#> 886  controllerType=0 controllerNumber=1 scan=1953           2    1
#> 887  controllerType=0 controllerNumber=1 scan=5774           3    1
#> 888  controllerType=0 controllerNumber=1 scan=5795           3    1
#> 889  controllerType=0 controllerNumber=1 scan=4019           2    1
#> 890  controllerType=0 controllerNumber=1 scan=4208           3    1
#> 891  controllerType=0 controllerNumber=1 scan=4960           3    1
#> 892  controllerType=0 controllerNumber=1 scan=5445           3    1
#> 893  controllerType=0 controllerNumber=1 scan=4284           2    1
#> 894  controllerType=0 controllerNumber=1 scan=4234           3    1
#> 895  controllerType=0 controllerNumber=1 scan=5699           3    1
#> 896  controllerType=0 controllerNumber=1 scan=5654           4    1
#> 897  controllerType=0 controllerNumber=1 scan=2320           3    1
#> 898  controllerType=0 controllerNumber=1 scan=4031           4    1
#> 899  controllerType=0 controllerNumber=1 scan=4873           2    1
#> 900  controllerType=0 controllerNumber=1 scan=4873           2    2
#> 901  controllerType=0 controllerNumber=1 scan=3738           2    1
#> 902  controllerType=0 controllerNumber=1 scan=2625           2    1
#> 903  controllerType=0 controllerNumber=1 scan=7031           2    1
#> 904  controllerType=0 controllerNumber=1 scan=7031           2    1
#> 905  controllerType=0 controllerNumber=1 scan=4442           2    1
#> 906  controllerType=0 controllerNumber=1 scan=6657           2    1
#> 907  controllerType=0 controllerNumber=1 scan=1332           2    1
#> 908  controllerType=0 controllerNumber=1 scan=5378           2    1
#> 909  controllerType=0 controllerNumber=1 scan=5144           2    1
#> 910  controllerType=0 controllerNumber=1 scan=4848           4    1
#> 911  controllerType=0 controllerNumber=1 scan=1210           3    1
#> 912  controllerType=0 controllerNumber=1 scan=6092           2    1
#> 913  controllerType=0 controllerNumber=1 scan=4760           3    1
#> 914  controllerType=0 controllerNumber=1 scan=5607           3    1
#> 915  controllerType=0 controllerNumber=1 scan=3840           2    1
#> 916  controllerType=0 controllerNumber=1 scan=6903           2    1
#> 917  controllerType=0 controllerNumber=1 scan=6848           2    1
#> 918  controllerType=0 controllerNumber=1 scan=4499           2    1
#> 919  controllerType=0 controllerNumber=1 scan=5571           2    1
#> 920  controllerType=0 controllerNumber=1 scan=5929           4    1
#> 921  controllerType=0 controllerNumber=1 scan=5929           4    1
#> 922  controllerType=0 controllerNumber=1 scan=5380           3    1
#> 923  controllerType=0 controllerNumber=1 scan=3190           2    1
#> 924  controllerType=0 controllerNumber=1 scan=4961           2    1
#> 925  controllerType=0 controllerNumber=1 scan=2650           3    1
#> 926  controllerType=0 controllerNumber=1 scan=5033           2    1
#> 927  controllerType=0 controllerNumber=1 scan=1733           3    1
#> 928  controllerType=0 controllerNumber=1 scan=6688           2    1
#> 929  controllerType=0 controllerNumber=1 scan=5519           3    1
#> 930  controllerType=0 controllerNumber=1 scan=3549           3    1
#> 931  controllerType=0 controllerNumber=1 scan=1333           2    1
#> 932  controllerType=0 controllerNumber=1 scan=5165           2    1
#> 933  controllerType=0 controllerNumber=1 scan=1295           3    1
#> 934  controllerType=0 controllerNumber=1 scan=2597           2    1
#> 935  controllerType=0 controllerNumber=1 scan=1144           3    1
#> 936  controllerType=0 controllerNumber=1 scan=6659           2    1
#> 937  controllerType=0 controllerNumber=1 scan=6136           4    1
#> 938  controllerType=0 controllerNumber=1 scan=4486           2    1
#> 939  controllerType=0 controllerNumber=1 scan=1528           2    1
#> 940  controllerType=0 controllerNumber=1 scan=2179           2    1
#> 941  controllerType=0 controllerNumber=1 scan=4907           2    1
#> 942  controllerType=0 controllerNumber=1 scan=2076           4    1
#> 943  controllerType=0 controllerNumber=1 scan=6699           4    1
#> 944  controllerType=0 controllerNumber=1 scan=6388           2    1
#> 945  controllerType=0 controllerNumber=1 scan=1405           3    1
#> 946  controllerType=0 controllerNumber=1 scan=4113           3    1
#> 947  controllerType=0 controllerNumber=1 scan=1914           3    1
#> 948  controllerType=0 controllerNumber=1 scan=1209           2    1
#> 949  controllerType=0 controllerNumber=1 scan=6201           3    1
#> 950  controllerType=0 controllerNumber=1 scan=4599           2    1
#> 951  controllerType=0 controllerNumber=1 scan=6618           2    1
#> 952  controllerType=0 controllerNumber=1 scan=4750           3    1
#> 953  controllerType=0 controllerNumber=1 scan=2960           3    1
#> 954  controllerType=0 controllerNumber=1 scan=4176           2    1
#> 955  controllerType=0 controllerNumber=1 scan=5131           3    1
#> 956  controllerType=0 controllerNumber=1 scan=2100           2    1
#> 957  controllerType=0 controllerNumber=1 scan=2846           3    1
#> 958  controllerType=0 controllerNumber=1 scan=6357           2    1
#> 959  controllerType=0 controllerNumber=1 scan=5685           3    1
#> 960  controllerType=0 controllerNumber=1 scan=4333           3    1
#> 961  controllerType=0 controllerNumber=1 scan=6003           2    1
#> 962  controllerType=0 controllerNumber=1 scan=6542           2    1
#> 963  controllerType=0 controllerNumber=1 scan=3409           3    1
#> 964  controllerType=0 controllerNumber=1 scan=7401           4    1
#> 965  controllerType=0 controllerNumber=1 scan=4340           3    1
#> 966  controllerType=0 controllerNumber=1 scan=3796           3    1
#> 967  controllerType=0 controllerNumber=1 scan=2440           2    1
#> 968  controllerType=0 controllerNumber=1 scan=1680           2    1
#> 969  controllerType=0 controllerNumber=1 scan=5801           3    1
#> 970  controllerType=0 controllerNumber=1 scan=6460           4    1
#> 971  controllerType=0 controllerNumber=1 scan=5375           3    1
#> 972  controllerType=0 controllerNumber=1 scan=2447           3    1
#> 973  controllerType=0 controllerNumber=1 scan=5982           4    1
#> 974  controllerType=0 controllerNumber=1 scan=4008           3    1
#> 975  controllerType=0 controllerNumber=1 scan=3644           2    1
#> 976  controllerType=0 controllerNumber=1 scan=6630           2    1
#> 977  controllerType=0 controllerNumber=1 scan=3244           2    1
#> 978  controllerType=0 controllerNumber=1 scan=6137           4    1
#> 979  controllerType=0 controllerNumber=1 scan=3992           2    1
#> 980  controllerType=0 controllerNumber=1 scan=4986           3    1
#> 981  controllerType=0 controllerNumber=1 scan=3860           2    1
#> 982  controllerType=0 controllerNumber=1 scan=1604           2    1
#> 983  controllerType=0 controllerNumber=1 scan=6519           2    1
#> 984  controllerType=0 controllerNumber=1 scan=6313           2    1
#> 985  controllerType=0 controllerNumber=1 scan=3518           3    1
#> 986  controllerType=0 controllerNumber=1 scan=5684           2    1
#> 987  controllerType=0 controllerNumber=1 scan=5865           4    1
#> 988  controllerType=0 controllerNumber=1 scan=1416           2    1
#> 989  controllerType=0 controllerNumber=1 scan=5222           3    1
#> 990  controllerType=0 controllerNumber=1 scan=1974           2    1
#> 991  controllerType=0 controllerNumber=1 scan=6387           4    1
#> 992  controllerType=0 controllerNumber=1 scan=2506           3    1
#> 993  controllerType=0 controllerNumber=1 scan=2230           4    1
#> 994  controllerType=0 controllerNumber=1 scan=7185           3    1
#> 995  controllerType=0 controllerNumber=1 scan=5808           2    1
#> 996  controllerType=0 controllerNumber=1 scan=5899           3    1
#> 997  controllerType=0 controllerNumber=1 scan=6218           2    1
#> 998  controllerType=0 controllerNumber=1 scan=6218           2    1
#> 999  controllerType=0 controllerNumber=1 scan=2496           2    1
#> 1000 controllerType=0 controllerNumber=1 scan=5940           3    1
#> 1001 controllerType=0 controllerNumber=1 scan=4755           2    1
#> 1002 controllerType=0 controllerNumber=1 scan=6035           3    1
#> 1003 controllerType=0 controllerNumber=1 scan=4240           2    1
#> 1004 controllerType=0 controllerNumber=1 scan=1516           2    1
#> 1005 controllerType=0 controllerNumber=1 scan=1994           2    1
#> 1006 controllerType=0 controllerNumber=1 scan=3595           2    1
#> 1007 controllerType=0 controllerNumber=1 scan=5921           3    1
#> 1008 controllerType=0 controllerNumber=1 scan=2064           2    1
#> 1009 controllerType=0 controllerNumber=1 scan=7015           2    1
#> 1010 controllerType=0 controllerNumber=1 scan=3234           2    1
#> 1011 controllerType=0 controllerNumber=1 scan=6208           2    1
#> 1012 controllerType=0 controllerNumber=1 scan=1197           3    1
#> 1013 controllerType=0 controllerNumber=1 scan=5297           3    1
#> 1014 controllerType=0 controllerNumber=1 scan=4770           2    2
#> 1015 controllerType=0 controllerNumber=1 scan=3768           2    1
#> 1016 controllerType=0 controllerNumber=1 scan=4529           3    1
#> 1017 controllerType=0 controllerNumber=1 scan=6319           4    1
#> 1018 controllerType=0 controllerNumber=1 scan=6707           3    1
#> 1019 controllerType=0 controllerNumber=1 scan=2352           2    1
#> 1020 controllerType=0 controllerNumber=1 scan=1155           4    1
#> 1021 controllerType=0 controllerNumber=1 scan=2746           2    1
#> 1022 controllerType=0 controllerNumber=1 scan=3015           2    1
#> 1023 controllerType=0 controllerNumber=1 scan=1315           2    1
#> 1024 controllerType=0 controllerNumber=1 scan=6438           3    1
#> 1025 controllerType=0 controllerNumber=1 scan=6438           3    2
#> 1026 controllerType=0 controllerNumber=1 scan=5969           4    1
#> 1027 controllerType=0 controllerNumber=1 scan=7077           2    1
#> 1028 controllerType=0 controllerNumber=1 scan=2912           2    1
#> 1029 controllerType=0 controllerNumber=1 scan=3459           3    1
#> 1030 controllerType=0 controllerNumber=1 scan=3581           2    1
#> 1031 controllerType=0 controllerNumber=1 scan=5354           2    1
#> 1032 controllerType=0 controllerNumber=1 scan=1480           3    1
#> 1033 controllerType=0 controllerNumber=1 scan=3876           3    1
#> 1034 controllerType=0 controllerNumber=1 scan=5432           3    1
#> 1035 controllerType=0 controllerNumber=1 scan=3226           2    1
#> 1036 controllerType=0 controllerNumber=1 scan=3502           3    1
#> 1037 controllerType=0 controllerNumber=1 scan=1964           2    1
#> 1038 controllerType=0 controllerNumber=1 scan=6042           2    1
#> 1039 controllerType=0 controllerNumber=1 scan=4939           3    1
#> 1040 controllerType=0 controllerNumber=1 scan=5515           2    1
#> 1041 controllerType=0 controllerNumber=1 scan=2187           2    1
#> 1042 controllerType=0 controllerNumber=1 scan=5734           4    1
#> 1043 controllerType=0 controllerNumber=1 scan=5818           2    1
#> 1044 controllerType=0 controllerNumber=1 scan=5180           2    1
#> 1045 controllerType=0 controllerNumber=1 scan=5927           2    1
#> 1046 controllerType=0 controllerNumber=1 scan=1049           3    1
#> 1047 controllerType=0 controllerNumber=1 scan=5712           4    1
#> 1048 controllerType=0 controllerNumber=1 scan=3997           3    1
#> 1049 controllerType=0 controllerNumber=1 scan=6390           3    1
#> 1050 controllerType=0 controllerNumber=1 scan=6098           3    1
#> 1051 controllerType=0 controllerNumber=1 scan=5963           3    1
#> 1052 controllerType=0 controllerNumber=1 scan=2852           3    1
#> 1053 controllerType=0 controllerNumber=1 scan=2896           2    1
#> 1054 controllerType=0 controllerNumber=1 scan=2896           2    2
#> 1055 controllerType=0 controllerNumber=1 scan=5947           3    1
#> 1056 controllerType=0 controllerNumber=1 scan=5025           2    1
#> 1057 controllerType=0 controllerNumber=1 scan=4253           3    1
#> 1058 controllerType=0 controllerNumber=1 scan=5083           3    1
#> 1059 controllerType=0 controllerNumber=1 scan=6439           3    1
#> 1060  controllerType=0 controllerNumber=1 scan=988           4    1
#> 1061 controllerType=0 controllerNumber=1 scan=2872           2    1
#> 1062 controllerType=0 controllerNumber=1 scan=2561           2    1
#> 1063 controllerType=0 controllerNumber=1 scan=2297           2    1
#> 1064 controllerType=0 controllerNumber=1 scan=4995           2    1
#> 1065 controllerType=0 controllerNumber=1 scan=1222           2    1
#> 1066 controllerType=0 controllerNumber=1 scan=3719           2    1
#> 1067 controllerType=0 controllerNumber=1 scan=6723           3    1
#> 1068 controllerType=0 controllerNumber=1 scan=6366           4    1
#> 1069 controllerType=0 controllerNumber=1 scan=7166           2    1
#> 1070 controllerType=0 controllerNumber=1 scan=1157           2    1
#> 1071 controllerType=0 controllerNumber=1 scan=2156           2    1
#> 1072 controllerType=0 controllerNumber=1 scan=4290           4    1
#> 1073 controllerType=0 controllerNumber=1 scan=4445           3    1
#> 1074 controllerType=0 controllerNumber=1 scan=5663           2    1
#> 1075 controllerType=0 controllerNumber=1 scan=3213           2    1
#> 1076 controllerType=0 controllerNumber=1 scan=3785           3    1
#> 1077 controllerType=0 controllerNumber=1 scan=1689           3    1
#> 1078 controllerType=0 controllerNumber=1 scan=4555           2    1
#> 1079 controllerType=0 controllerNumber=1 scan=3176           3    1
#> 1080 controllerType=0 controllerNumber=1 scan=1738           2    1
#> 1081 controllerType=0 controllerNumber=1 scan=1996           2    1
#> 1082 controllerType=0 controllerNumber=1 scan=6511           3    1
#> 1083 controllerType=0 controllerNumber=1 scan=5319           3    2
#> 1084 controllerType=0 controllerNumber=1 scan=4742           2    1
#> 1085 controllerType=0 controllerNumber=1 scan=5390           4    1
#> 1086 controllerType=0 controllerNumber=1 scan=6113           3    1
#> 1087 controllerType=0 controllerNumber=1 scan=2588           2    1
#> 1088 controllerType=0 controllerNumber=1 scan=5514           3    1
#> 1089 controllerType=0 controllerNumber=1 scan=1246           2    1
#> 1090 controllerType=0 controllerNumber=1 scan=4353           2    1
#> 1091 controllerType=0 controllerNumber=1 scan=6091           3    1
#> 1092 controllerType=0 controllerNumber=1 scan=4956           3    1
#> 1093 controllerType=0 controllerNumber=1 scan=1534           2    1
#> 1094 controllerType=0 controllerNumber=1 scan=2732           3    1
#> 1095 controllerType=0 controllerNumber=1 scan=4530           2    1
#> 1096 controllerType=0 controllerNumber=1 scan=5476           2    1
#> 1097 controllerType=0 controllerNumber=1 scan=5488           3    1
#> 1098 controllerType=0 controllerNumber=1 scan=5706           3    1
#> 1099 controllerType=0 controllerNumber=1 scan=1105           2    1
#> 1100 controllerType=0 controllerNumber=1 scan=2767           2    1
#> 1101 controllerType=0 controllerNumber=1 scan=1244           2    1
#> 1102 controllerType=0 controllerNumber=1 scan=4723           3    1
#> 1103 controllerType=0 controllerNumber=1 scan=5146           4    1
#> 1104 controllerType=0 controllerNumber=1 scan=2517           4    1
#> 1105 controllerType=0 controllerNumber=1 scan=5399           4    1
#> 1106 controllerType=0 controllerNumber=1 scan=6416           4    1
#> 1107 controllerType=0 controllerNumber=1 scan=6501           2    2
#> 1108 controllerType=0 controllerNumber=1 scan=5630           4    1
#> 1109 controllerType=0 controllerNumber=1 scan=6445           3    1
#> 1110 controllerType=0 controllerNumber=1 scan=1913           2    1
#> 1111 controllerType=0 controllerNumber=1 scan=1851           2    1
#> 1112 controllerType=0 controllerNumber=1 scan=6527           3    1
#> 1113 controllerType=0 controllerNumber=1 scan=2724           3    1
#> 1114 controllerType=0 controllerNumber=1 scan=4448           3    1
#> 1115 controllerType=0 controllerNumber=1 scan=6227           2    1
#> 1116 controllerType=0 controllerNumber=1 scan=1399           2    1
#> 1117 controllerType=0 controllerNumber=1 scan=4518           3    1
#> 1118 controllerType=0 controllerNumber=1 scan=5317           3    1
#> 1119 controllerType=0 controllerNumber=1 scan=4650           2    1
#> 1120 controllerType=0 controllerNumber=1 scan=5820           2    1
#> 1121 controllerType=0 controllerNumber=1 scan=4943           3    1
#> 1122 controllerType=0 controllerNumber=1 scan=1059           3    1
#> 1123 controllerType=0 controllerNumber=1 scan=3318           2    1
#> 1124 controllerType=0 controllerNumber=1 scan=3373           3    1
#> 1125 controllerType=0 controllerNumber=1 scan=6095           2    1
#> 1126 controllerType=0 controllerNumber=1 scan=6333           3    1
#> 1127 controllerType=0 controllerNumber=1 scan=1973           2    1
#> 1128 controllerType=0 controllerNumber=1 scan=4606           2    1
#> 1129 controllerType=0 controllerNumber=1 scan=4432           3    1
#> 1130 controllerType=0 controllerNumber=1 scan=6158           2    1
#> 1131 controllerType=0 controllerNumber=1 scan=5041           2    1
#> 1132 controllerType=0 controllerNumber=1 scan=3806           3    1
#> 1133 controllerType=0 controllerNumber=1 scan=7445           2    1
#> 1134 controllerType=0 controllerNumber=1 scan=1485           2    1
#> 1135 controllerType=0 controllerNumber=1 scan=3722           3    1
#> 1136 controllerType=0 controllerNumber=1 scan=4802           3    1
#> 1137 controllerType=0 controllerNumber=1 scan=6326           4    1
#> 1138 controllerType=0 controllerNumber=1 scan=6263           3    1
#> 1139 controllerType=0 controllerNumber=1 scan=1453           2    1
#> 1140 controllerType=0 controllerNumber=1 scan=6825           2    1
#> 1141 controllerType=0 controllerNumber=1 scan=1852           2    1
#> 1142 controllerType=0 controllerNumber=1 scan=3102           2    1
#> 1143 controllerType=0 controllerNumber=1 scan=3297           3    1
#> 1144 controllerType=0 controllerNumber=1 scan=5054           2    1
#> 1145 controllerType=0 controllerNumber=1 scan=2638           2    1
#> 1146 controllerType=0 controllerNumber=1 scan=3360           2    1
#> 1147 controllerType=0 controllerNumber=1 scan=1739           2    1
#> 1148 controllerType=0 controllerNumber=1 scan=4202           2    1
#> 1149 controllerType=0 controllerNumber=1 scan=3910           2    1
#> 1150 controllerType=0 controllerNumber=1 scan=4099           3    1
#> 1151 controllerType=0 controllerNumber=1 scan=4099           3    1
#> 1152 controllerType=0 controllerNumber=1 scan=4099           3    1
#> 1153 controllerType=0 controllerNumber=1 scan=5981           3    1
#> 1154 controllerType=0 controllerNumber=1 scan=2788           2    1
#> 1155 controllerType=0 controllerNumber=1 scan=2467           2    1
#> 1156 controllerType=0 controllerNumber=1 scan=4851           4    1
#> 1157 controllerType=0 controllerNumber=1 scan=5631           2    1
#> 1158 controllerType=0 controllerNumber=1 scan=2300           4    1
#> 1159 controllerType=0 controllerNumber=1 scan=1358           3    1
#> 1160 controllerType=0 controllerNumber=1 scan=4168           3    1
#> 1161 controllerType=0 controllerNumber=1 scan=4339           3    1
#> 1162 controllerType=0 controllerNumber=1 scan=7059           2    1
#> 1163 controllerType=0 controllerNumber=1 scan=5532           2    1
#> 1164 controllerType=0 controllerNumber=1 scan=3326           3    1
#> 1165 controllerType=0 controllerNumber=1 scan=1183           2    1
#> 1166 controllerType=0 controllerNumber=1 scan=6207           4    1
#> 1167 controllerType=0 controllerNumber=1 scan=5321           4    1
#> 1168 controllerType=0 controllerNumber=1 scan=5321           4    2
#> 1169 controllerType=0 controllerNumber=1 scan=5539           2    1
#> 1170 controllerType=0 controllerNumber=1 scan=7249           2    1
#> 1171 controllerType=0 controllerNumber=1 scan=2310           2    1
#> 1172 controllerType=0 controllerNumber=1 scan=3186           4    1
#> 1173 controllerType=0 controllerNumber=1 scan=3953           3    1
#> 1174 controllerType=0 controllerNumber=1 scan=3898           3    1
#> 1175 controllerType=0 controllerNumber=1 scan=6259           3    1
#> 1176 controllerType=0 controllerNumber=1 scan=4053           2    1
#> 1177 controllerType=0 controllerNumber=1 scan=5357           2    1
#> 1178 controllerType=0 controllerNumber=1 scan=3496           3    1
#> 1179 controllerType=0 controllerNumber=1 scan=3496           3    2
#> 1180 controllerType=0 controllerNumber=1 scan=5824           2    1
#> 1181 controllerType=0 controllerNumber=1 scan=2789           3    1
#> 1182 controllerType=0 controllerNumber=1 scan=3442           3    1
#> 1183 controllerType=0 controllerNumber=1 scan=7362           2    1
#> 1184 controllerType=0 controllerNumber=1 scan=4133           2    1
#> 1185 controllerType=0 controllerNumber=1 scan=5202           3    1
#> 1186 controllerType=0 controllerNumber=1 scan=1300           4    1
#> 1187 controllerType=0 controllerNumber=1 scan=3317           2    1
#> 1188 controllerType=0 controllerNumber=1 scan=4465           3    1
#> 1189 controllerType=0 controllerNumber=1 scan=2850           3    1
#> 1190 controllerType=0 controllerNumber=1 scan=1307           2    1
#> 1191 controllerType=0 controllerNumber=1 scan=6027           2    1
#> 1192 controllerType=0 controllerNumber=1 scan=1086           3    1
#> 1193 controllerType=0 controllerNumber=1 scan=7017           2    1
#> 1194 controllerType=0 controllerNumber=1 scan=4817           3    1
#> 1195 controllerType=0 controllerNumber=1 scan=5651           3    1
#> 1196 controllerType=0 controllerNumber=1 scan=6245           2    1
#> 1197 controllerType=0 controllerNumber=1 scan=1414           3    1
#> 1198 controllerType=0 controllerNumber=1 scan=5459           3    1
#> 1199 controllerType=0 controllerNumber=1 scan=6159           2    1
#> 1200 controllerType=0 controllerNumber=1 scan=6159           2    2
#> 1201 controllerType=0 controllerNumber=1 scan=4200           3    1
#> 1202 controllerType=0 controllerNumber=1 scan=4991           2    1
#> 1203 controllerType=0 controllerNumber=1 scan=3707           2    1
#> 1204 controllerType=0 controllerNumber=1 scan=6449           3    1
#> 1205 controllerType=0 controllerNumber=1 scan=1262           3    1
#> 1206 controllerType=0 controllerNumber=1 scan=4581           2    1
#> 1207 controllerType=0 controllerNumber=1 scan=3832           3    1
#> 1208 controllerType=0 controllerNumber=1 scan=1472           2    1
#> 1209 controllerType=0 controllerNumber=1 scan=4903           2    1
#> 1210 controllerType=0 controllerNumber=1 scan=5002           3    1
#> 1211 controllerType=0 controllerNumber=1 scan=5130           4    1
#> 1212 controllerType=0 controllerNumber=1 scan=4707           3    1
#> 1213 controllerType=0 controllerNumber=1 scan=6143           4    1
#> 1214 controllerType=0 controllerNumber=1 scan=6288           3    1
#> 1215 controllerType=0 controllerNumber=1 scan=6640           3    1
#> 1216 controllerType=0 controllerNumber=1 scan=4344           2    1
#> 1217 controllerType=0 controllerNumber=1 scan=5682           4    1
#> 1218 controllerType=0 controllerNumber=1 scan=6421           4    1
#> 1219 controllerType=0 controllerNumber=1 scan=4033           3    1
#> 1220 controllerType=0 controllerNumber=1 scan=4232           3    1
#> 1221 controllerType=0 controllerNumber=1 scan=1234           2    1
#> 1222 controllerType=0 controllerNumber=1 scan=1029           3    1
#> 1223 controllerType=0 controllerNumber=1 scan=5243           3    1
#> 1224 controllerType=0 controllerNumber=1 scan=6076           3    1
#> 1225 controllerType=0 controllerNumber=1 scan=1241           3    1
#> 1226 controllerType=0 controllerNumber=1 scan=3262           3    1
#> 1227 controllerType=0 controllerNumber=1 scan=3003           2    1
#> 1228 controllerType=0 controllerNumber=1 scan=5691           3    1
#> 1229 controllerType=0 controllerNumber=1 scan=7080           2    1
#> 1230 controllerType=0 controllerNumber=1 scan=5550           3    1
#> 1231 controllerType=0 controllerNumber=1 scan=5383           2    1
#> 1232 controllerType=0 controllerNumber=1 scan=2831           2    1
#> 1233 controllerType=0 controllerNumber=1 scan=3378           2    1
#> 1234 controllerType=0 controllerNumber=1 scan=4069           2    1
#> 1235 controllerType=0 controllerNumber=1 scan=1084           2    1
#> 1236 controllerType=0 controllerNumber=1 scan=2658           2    1
#> 1237 controllerType=0 controllerNumber=1 scan=2088           2    1
#> 1238 controllerType=0 controllerNumber=1 scan=3140           3    1
#> 1239 controllerType=0 controllerNumber=1 scan=3140           3    2
#> 1240 controllerType=0 controllerNumber=1 scan=1723           2    1
#> 1241 controllerType=0 controllerNumber=1 scan=1723           2    1
#> 1242 controllerType=0 controllerNumber=1 scan=2463           2    1
#> 1243 controllerType=0 controllerNumber=1 scan=6617           4    1
#> 1244 controllerType=0 controllerNumber=1 scan=1273           2    1
#> 1245 controllerType=0 controllerNumber=1 scan=1985           2    1
#> 1246 controllerType=0 controllerNumber=1 scan=4372           2    1
#> 1247 controllerType=0 controllerNumber=1 scan=7466           2    1
#> 1248 controllerType=0 controllerNumber=1 scan=1322           2    1
#> 1249 controllerType=0 controllerNumber=1 scan=4412           4    1
#> 1250 controllerType=0 controllerNumber=1 scan=3868           2    1
#> 1251 controllerType=0 controllerNumber=1 scan=3868           2    2
#> 1252 controllerType=0 controllerNumber=1 scan=5701           3    1
#> 1253 controllerType=0 controllerNumber=1 scan=4913           3    1
#> 1254 controllerType=0 controllerNumber=1 scan=6268           2    1
#> 1255 controllerType=0 controllerNumber=1 scan=6452           3    1
#> 1256 controllerType=0 controllerNumber=1 scan=5248           2    1
#> 1257 controllerType=0 controllerNumber=1 scan=3397           2    1
#> 1258 controllerType=0 controllerNumber=1 scan=3649           3    1
#> 1259 controllerType=0 controllerNumber=1 scan=5199           3    1
#> 1260 controllerType=0 controllerNumber=1 scan=5512           3    1
#> 1261 controllerType=0 controllerNumber=1 scan=6209           3    1
#> 1262 controllerType=0 controllerNumber=1 scan=5730           3    1
#> 1263 controllerType=0 controllerNumber=1 scan=6669           3    1
#> 1264 controllerType=0 controllerNumber=1 scan=2469           2    1
#> 1265 controllerType=0 controllerNumber=1 scan=4037           2    1
#> 1266 controllerType=0 controllerNumber=1 scan=4273           2    1
#> 1267 controllerType=0 controllerNumber=1 scan=7290           2    1
#> 1268 controllerType=0 controllerNumber=1 scan=3844           4    1
#> 1269 controllerType=0 controllerNumber=1 scan=6417           3    1
#> 1270 controllerType=0 controllerNumber=1 scan=4178           2    1
#> 1271 controllerType=0 controllerNumber=1 scan=5614           3    1
#> 1272 controllerType=0 controllerNumber=1 scan=6264           3    1
#> 1273 controllerType=0 controllerNumber=1 scan=6364           3    1
#> 1274 controllerType=0 controllerNumber=1 scan=6456           2    1
#> 1275 controllerType=0 controllerNumber=1 scan=2228           4    1
#> 1276 controllerType=0 controllerNumber=1 scan=6726           2    1
#> 1277 controllerType=0 controllerNumber=1 scan=3471           5    1
#> 1278 controllerType=0 controllerNumber=1 scan=6362           4    1
#> 1279 controllerType=0 controllerNumber=1 scan=6824           2    1
#> 1280 controllerType=0 controllerNumber=1 scan=2982           2    1
#> 1281 controllerType=0 controllerNumber=1 scan=3883           3    1
#> 1282 controllerType=0 controllerNumber=1 scan=7251           2    1
#> 1283 controllerType=0 controllerNumber=1 scan=6375           3    1
#> 1284 controllerType=0 controllerNumber=1 scan=4693           2    1
#> 1285 controllerType=0 controllerNumber=1 scan=2820           2    1
#> 1286 controllerType=0 controllerNumber=1 scan=6463           2    1
#> 1287 controllerType=0 controllerNumber=1 scan=1242           2    1
#> 1288 controllerType=0 controllerNumber=1 scan=6509           3    1
#> 1289 controllerType=0 controllerNumber=1 scan=6032           3    1
#> 1290 controllerType=0 controllerNumber=1 scan=6228           2    1
#> 1291 controllerType=0 controllerNumber=1 scan=1684           2    1
#> 1292 controllerType=0 controllerNumber=1 scan=1483           2    1
#> 1293 controllerType=0 controllerNumber=1 scan=4330           2    1
#> 1294 controllerType=0 controllerNumber=1 scan=7398           2    1
#> 1295 controllerType=0 controllerNumber=1 scan=2627           2    1
#> 1296 controllerType=0 controllerNumber=1 scan=5710           3    1
#> 1297 controllerType=0 controllerNumber=1 scan=5914           5    1
#> 1298 controllerType=0 controllerNumber=1 scan=4763           2    1
#> 1299 controllerType=0 controllerNumber=1 scan=7155           2    1
#> 1300 controllerType=0 controllerNumber=1 scan=1548           2    1
#> 1301 controllerType=0 controllerNumber=1 scan=5010           3    1
#> 1302 controllerType=0 controllerNumber=1 scan=3612           2    1
#> 1303 controllerType=0 controllerNumber=1 scan=5209           3    1
#> 1304 controllerType=0 controllerNumber=1 scan=5646           3    1
#> 1305 controllerType=0 controllerNumber=1 scan=4661           2    1
#> 1306 controllerType=0 controllerNumber=1 scan=4249           2    1
#> 1307 controllerType=0 controllerNumber=1 scan=6559           3    1
#> 1308 controllerType=0 controllerNumber=1 scan=3721           3    1
#> 1309 controllerType=0 controllerNumber=1 scan=5826           3    1
#> 1310 controllerType=0 controllerNumber=1 scan=3308           2    1
#> 1311 controllerType=0 controllerNumber=1 scan=5125           3    1
#> 1312 controllerType=0 controllerNumber=1 scan=2557           3    1
#> 1313 controllerType=0 controllerNumber=1 scan=1375           3    1
#> 1314 controllerType=0 controllerNumber=1 scan=4431           3    1
#> 1315 controllerType=0 controllerNumber=1 scan=6507           3    1
#> 1316 controllerType=0 controllerNumber=1 scan=1488           2    1
#> 1317 controllerType=0 controllerNumber=1 scan=2958           2    1
#> 1318 controllerType=0 controllerNumber=1 scan=2553           2    1
#> 1319 controllerType=0 controllerNumber=1 scan=6004           4    1
#> 1320 controllerType=0 controllerNumber=1 scan=4839           3    1
#> 1321 controllerType=0 controllerNumber=1 scan=5505           2    1
#> 1322 controllerType=0 controllerNumber=1 scan=6596           3    1
#> 1323 controllerType=0 controllerNumber=1 scan=4268           2    1
#> 1324 controllerType=0 controllerNumber=1 scan=6405           4    1
#> 1325 controllerType=0 controllerNumber=1 scan=2399           3    1
#> 1326 controllerType=0 controllerNumber=1 scan=3812           3    1
#> 1327 controllerType=0 controllerNumber=1 scan=1576           2    1
#> 1328 controllerType=0 controllerNumber=1 scan=3701           3    1
#> 1329 controllerType=0 controllerNumber=1 scan=2647           2    1
#> 1330 controllerType=0 controllerNumber=1 scan=5394           2    1
#> 1331 controllerType=0 controllerNumber=1 scan=4973           2    1
#> 1332 controllerType=0 controllerNumber=1 scan=3173           2    1
#> 1333 controllerType=0 controllerNumber=1 scan=6016           4    1
#> 1334 controllerType=0 controllerNumber=1 scan=4628           3    1
#> 1335 controllerType=0 controllerNumber=1 scan=2971           2    1
#> 1336 controllerType=0 controllerNumber=1 scan=5679           3    1
#> 1337 controllerType=0 controllerNumber=1 scan=3486           3    1
#> 1338 controllerType=0 controllerNumber=1 scan=5958           3    1
#> 1339 controllerType=0 controllerNumber=1 scan=3873           3    1
#> 1340 controllerType=0 controllerNumber=1 scan=2743           3    1
#> 1341 controllerType=0 controllerNumber=1 scan=1612           2    1
#> 1342 controllerType=0 controllerNumber=1 scan=3339           2    1
#> 1343 controllerType=0 controllerNumber=1 scan=6369           2    1
#> 1344 controllerType=0 controllerNumber=1 scan=5013           3    1
#> 1345 controllerType=0 controllerNumber=1 scan=3925           3    1
#> 1346 controllerType=0 controllerNumber=1 scan=4243           2    1
#> 1347 controllerType=0 controllerNumber=1 scan=5980           3    1
#> 1348 controllerType=0 controllerNumber=1 scan=3400           3    1
#> 1349 controllerType=0 controllerNumber=1 scan=5177           3    1
#> 1350 controllerType=0 controllerNumber=1 scan=4854           3    1
#> 1351 controllerType=0 controllerNumber=1 scan=6334           4    1
#> 1352 controllerType=0 controllerNumber=1 scan=5531           2    1
#> 1353 controllerType=0 controllerNumber=1 scan=1240           3    1
#> 1354 controllerType=0 controllerNumber=1 scan=7450           2    1
#> 1355 controllerType=0 controllerNumber=1 scan=3856           3    1
#> 1356 controllerType=0 controllerNumber=1 scan=1712           2    1
#> 1357 controllerType=0 controllerNumber=1 scan=3703           3    1
#> 1358 controllerType=0 controllerNumber=1 scan=4374           2    1
#> 1359 controllerType=0 controllerNumber=1 scan=3673           2    1
#> 1360 controllerType=0 controllerNumber=1 scan=5972           2    1
#> 1361 controllerType=0 controllerNumber=1 scan=2113           3    1
#> 1362 controllerType=0 controllerNumber=1 scan=4722           2    1
#> 1363 controllerType=0 controllerNumber=1 scan=4619           3    1
#> 1364 controllerType=0 controllerNumber=1 scan=6204           4    1
#> 1365 controllerType=0 controllerNumber=1 scan=5417           4    1
#> 1366 controllerType=0 controllerNumber=1 scan=1151           2    1
#> 1367 controllerType=0 controllerNumber=1 scan=2242           3    1
#> 1368 controllerType=0 controllerNumber=1 scan=5448           3    1
#> 1369 controllerType=0 controllerNumber=1 scan=4951           3    1
#> 1370 controllerType=0 controllerNumber=1 scan=2740           4    1
#> 1371 controllerType=0 controllerNumber=1 scan=6217           4    1
#> 1372 controllerType=0 controllerNumber=1 scan=1535           2    1
#> 1373 controllerType=0 controllerNumber=1 scan=6291           2    1
#> 1374 controllerType=0 controllerNumber=1 scan=2920           2    1
#> 1375 controllerType=0 controllerNumber=1 scan=6339           2    1
#> 1376 controllerType=0 controllerNumber=1 scan=6754           2    1
#> 1377 controllerType=0 controllerNumber=1 scan=1509           2    1
#> 1378 controllerType=0 controllerNumber=1 scan=5287           3    1
#> 1379 controllerType=0 controllerNumber=1 scan=6514           4    1
#> 1380 controllerType=0 controllerNumber=1 scan=3625           2    1
#> 1381 controllerType=0 controllerNumber=1 scan=1774           2    1
#> 1382 controllerType=0 controllerNumber=1 scan=1774           2    1
#> 1383 controllerType=0 controllerNumber=1 scan=1774           2    1
#> 1384 controllerType=0 controllerNumber=1 scan=5212           4    1
#> 1385 controllerType=0 controllerNumber=1 scan=3955           3    1
#> 1386 controllerType=0 controllerNumber=1 scan=1611           2    1
#> 1387 controllerType=0 controllerNumber=1 scan=2358           3    1
#> 1388 controllerType=0 controllerNumber=1 scan=2003           2    1
#> 1389 controllerType=0 controllerNumber=1 scan=4287           3    1
#> 1390 controllerType=0 controllerNumber=1 scan=5141           3    1
#> 1391 controllerType=0 controllerNumber=1 scan=2999           2    1
#> 1392 controllerType=0 controllerNumber=1 scan=3180           2    1
#> 1393 controllerType=0 controllerNumber=1 scan=1697           3    1
#> 1394 controllerType=0 controllerNumber=1 scan=1200           4    1
#> 1395 controllerType=0 controllerNumber=1 scan=5975           2    1
#> 1396 controllerType=0 controllerNumber=1 scan=1741           2    1
#> 1397 controllerType=0 controllerNumber=1 scan=3780           2    1
#> 1398 controllerType=0 controllerNumber=1 scan=4169           2    1
#> 1399 controllerType=0 controllerNumber=1 scan=6430           3    1
#> 1400 controllerType=0 controllerNumber=1 scan=7255           2    1
#> 1401 controllerType=0 controllerNumber=1 scan=4047           2    1
#> 1402 controllerType=0 controllerNumber=1 scan=6827           2    1
#> 1403 controllerType=0 controllerNumber=1 scan=4255           3    1
#> 1404 controllerType=0 controllerNumber=1 scan=5650           3    1
#> 1405 controllerType=0 controllerNumber=1 scan=6197           4    1
#> 1406 controllerType=0 controllerNumber=1 scan=6197           4    2
#> 1407 controllerType=0 controllerNumber=1 scan=5232           3    1
#> 1408 controllerType=0 controllerNumber=1 scan=1603           2    1
#> 1409 controllerType=0 controllerNumber=1 scan=1828           2    1
#> 1410 controllerType=0 controllerNumber=1 scan=3739           2    1
#> 1411 controllerType=0 controllerNumber=1 scan=5658           4    1
#> 1412 controllerType=0 controllerNumber=1 scan=6538           3    1
#> 1413 controllerType=0 controllerNumber=1 scan=6182           3    1
#> 1414 controllerType=0 controllerNumber=1 scan=6033           3    1
#> 1415 controllerType=0 controllerNumber=1 scan=5185           3    1
#> 1416 controllerType=0 controllerNumber=1 scan=6080           4    1
#> 1417 controllerType=0 controllerNumber=1 scan=6859           2    1
#> 1418 controllerType=0 controllerNumber=1 scan=4078           3    1
#> 1419 controllerType=0 controllerNumber=1 scan=6379           2    1
#> 1420 controllerType=0 controllerNumber=1 scan=1792           2    1
#> 1421 controllerType=0 controllerNumber=1 scan=3073           3    1
#> 1422 controllerType=0 controllerNumber=1 scan=3592           3    1
#> 1423 controllerType=0 controllerNumber=1 scan=5627           4    1
#> 1424 controllerType=0 controllerNumber=1 scan=1146           4    1
#> 1425 controllerType=0 controllerNumber=1 scan=5606           3    1
#> 1426 controllerType=0 controllerNumber=1 scan=5500           3    1
#> 1427 controllerType=0 controllerNumber=1 scan=2908           3    1
#> 1428 controllerType=0 controllerNumber=1 scan=1618           2    1
#> 1429 controllerType=0 controllerNumber=1 scan=4337           2    1
#> 1430 controllerType=0 controllerNumber=1 scan=3196           3    1
#> 1431 controllerType=0 controllerNumber=1 scan=2302           3    1
#> 1432 controllerType=0 controllerNumber=1 scan=4852           3    1
#> 1433 controllerType=0 controllerNumber=1 scan=6555           4    1
#> 1434 controllerType=0 controllerNumber=1 scan=6857           2    1
#> 1435 controllerType=0 controllerNumber=1 scan=2372           2    1
#> 1436 controllerType=0 controllerNumber=1 scan=5028           2    1
#> 1437 controllerType=0 controllerNumber=1 scan=5251           3    1
#> 1438 controllerType=0 controllerNumber=1 scan=3746           2    1
#> 1439 controllerType=0 controllerNumber=1 scan=4321           3    1
#> 1440 controllerType=0 controllerNumber=1 scan=6928           2    1
#> 1441 controllerType=0 controllerNumber=1 scan=4815           3    1
#> 1442 controllerType=0 controllerNumber=1 scan=4937           3    1
#> 1443 controllerType=0 controllerNumber=1 scan=1323           3    1
#> 1444 controllerType=0 controllerNumber=1 scan=6670           2    1
#> 1445 controllerType=0 controllerNumber=1 scan=1255           2    1
#> 1446 controllerType=0 controllerNumber=1 scan=4877           3    1
#> 1447 controllerType=0 controllerNumber=1 scan=5918           2    1
#> 1448 controllerType=0 controllerNumber=1 scan=5410           4    1
#> 1449 controllerType=0 controllerNumber=1 scan=4103           2    1
#> 1450 controllerType=0 controllerNumber=1 scan=1312           3    1
#> 1451 controllerType=0 controllerNumber=1 scan=1289           2    1
#> 1452 controllerType=0 controllerNumber=1 scan=3254           3    1
#> 1453 controllerType=0 controllerNumber=1 scan=5507           3    1
#> 1454 controllerType=0 controllerNumber=1 scan=2124           3    1
#> 1455 controllerType=0 controllerNumber=1 scan=1250           2    1
#> 1456 controllerType=0 controllerNumber=1 scan=4322           3    1
#> 1457 controllerType=0 controllerNumber=1 scan=3380           2    1
#> 1458 controllerType=0 controllerNumber=1 scan=1729           2    1
#> 1459 controllerType=0 controllerNumber=1 scan=2562           2    1
#> 1460 controllerType=0 controllerNumber=1 scan=7269           2    1
#> 1461 controllerType=0 controllerNumber=1 scan=6289           3    1
#> 1462 controllerType=0 controllerNumber=1 scan=1394           2    1
#> 1463 controllerType=0 controllerNumber=1 scan=6303           3    1
#> 1464 controllerType=0 controllerNumber=1 scan=5305           2    1
#> 1465 controllerType=0 controllerNumber=1 scan=6239           5    1
#> 1466 controllerType=0 controllerNumber=1 scan=3292           2    1
#> 1467 controllerType=0 controllerNumber=1 scan=6413           2    1
#> 1468 controllerType=0 controllerNumber=1 scan=4332           3    1
#> 1469 controllerType=0 controllerNumber=1 scan=4213           2    1
#> 1470 controllerType=0 controllerNumber=1 scan=2817           2    1
#> 1471 controllerType=0 controllerNumber=1 scan=6494           3    1
#> 1472 controllerType=0 controllerNumber=1 scan=6562           3    1
#> 1473 controllerType=0 controllerNumber=1 scan=4871           2    1
#> 1474 controllerType=0 controllerNumber=1 scan=4595           3    1
#> 1475 controllerType=0 controllerNumber=1 scan=2407           3    1
#> 1476 controllerType=0 controllerNumber=1 scan=2407           3    1
#> 1477 controllerType=0 controllerNumber=1 scan=2407           3    1
#> 1478 controllerType=0 controllerNumber=1 scan=3257           3    1
#> 1479 controllerType=0 controllerNumber=1 scan=3677           2    1
#> 1480 controllerType=0 controllerNumber=1 scan=4425           2    1
#> 1481 controllerType=0 controllerNumber=1 scan=2133           2    1
#> 1482 controllerType=0 controllerNumber=1 scan=6102           2    1
#> 1483 controllerType=0 controllerNumber=1 scan=7309           2    1
#> 1484 controllerType=0 controllerNumber=1 scan=4647           2    1
#> 1485 controllerType=0 controllerNumber=1 scan=3597           2    1
#> 1486 controllerType=0 controllerNumber=1 scan=5159           3    1
#> 1487 controllerType=0 controllerNumber=1 scan=5210           2    1
#> 1488 controllerType=0 controllerNumber=1 scan=5664           3    1
#> 1489 controllerType=0 controllerNumber=1 scan=3641           2    1
#> 1490 controllerType=0 controllerNumber=1 scan=6493           3    1
#> 1491 controllerType=0 controllerNumber=1 scan=1287           4    1
#> 1492 controllerType=0 controllerNumber=1 scan=2173           2    1
#> 1493 controllerType=0 controllerNumber=1 scan=3090           2    1
#> 1494 controllerType=0 controllerNumber=1 scan=3020           2    1
#> 1495 controllerType=0 controllerNumber=1 scan=2963           2    1
#> 1496 controllerType=0 controllerNumber=1 scan=1719           2    1
#> 1497 controllerType=0 controllerNumber=1 scan=6730           3    1
#> 1498 controllerType=0 controllerNumber=1 scan=6730           3    1
#> 1499 controllerType=0 controllerNumber=1 scan=5915           3    1
#> 1500 controllerType=0 controllerNumber=1 scan=1717           2    1
#> 1501 controllerType=0 controllerNumber=1 scan=5069           3    1
#> 1502 controllerType=0 controllerNumber=1 scan=4076           4    1
#> 1503 controllerType=0 controllerNumber=1 scan=2564           2    1
#> 1504 controllerType=0 controllerNumber=1 scan=4668           3    1
#> 1505 controllerType=0 controllerNumber=1 scan=1283           3    1
#> 1506 controllerType=0 controllerNumber=1 scan=4318           2    1
#> 1507 controllerType=0 controllerNumber=1 scan=5003           2    1
#> 1508 controllerType=0 controllerNumber=1 scan=5984           3    1
#> 1509 controllerType=0 controllerNumber=1 scan=2610           3    1
#> 1510 controllerType=0 controllerNumber=1 scan=5866           2    1
#> 1511 controllerType=0 controllerNumber=1 scan=4089           3    1
#> 1512 controllerType=0 controllerNumber=1 scan=4537           2    1
#> 1513 controllerType=0 controllerNumber=1 scan=4453           3    1
#> 1514 controllerType=0 controllerNumber=1 scan=1530           2    1
#> 1515 controllerType=0 controllerNumber=1 scan=5064           3    1
#> 1516 controllerType=0 controllerNumber=1 scan=3372           3    1
#> 1517 controllerType=0 controllerNumber=1 scan=7101           3    1
#> 1518 controllerType=0 controllerNumber=1 scan=4976           2    1
#> 1519 controllerType=0 controllerNumber=1 scan=4000           2    1
#> 1520 controllerType=0 controllerNumber=1 scan=4535           3    1
#> 1521 controllerType=0 controllerNumber=1 scan=6257           4    1
#> 1522 controllerType=0 controllerNumber=1 scan=6257           4    2
#> 1523 controllerType=0 controllerNumber=1 scan=1486           2    1
#> 1524 controllerType=0 controllerNumber=1 scan=2023           2    1
#> 1525 controllerType=0 controllerNumber=1 scan=4304           2    1
#> 1526 controllerType=0 controllerNumber=1 scan=1688           2    1
#> 1527 controllerType=0 controllerNumber=1 scan=6116           4    1
#> 1528 controllerType=0 controllerNumber=1 scan=4263           3    1
#> 1529 controllerType=0 controllerNumber=1 scan=3869           2    1
#> 1530 controllerType=0 controllerNumber=1 scan=4411           2    1
#> 1531 controllerType=0 controllerNumber=1 scan=1925           2    1
#> 1532 controllerType=0 controllerNumber=1 scan=1925           2    1
#> 1533 controllerType=0 controllerNumber=1 scan=1925           2    1
#> 1534 controllerType=0 controllerNumber=1 scan=4896           3    1
#> 1535 controllerType=0 controllerNumber=1 scan=5673           3    1
#> 1536 controllerType=0 controllerNumber=1 scan=4981           2    1
#> 1537 controllerType=0 controllerNumber=1 scan=2914           4    1
#> 1538 controllerType=0 controllerNumber=1 scan=3062           3    1
#> 1539 controllerType=0 controllerNumber=1 scan=5736           5    1
#> 1540 controllerType=0 controllerNumber=1 scan=4616           2    1
#> 1541 controllerType=0 controllerNumber=1 scan=1907           2    1
#> 1542 controllerType=0 controllerNumber=1 scan=3772           2    1
#> 1543 controllerType=0 controllerNumber=1 scan=2055           2    1
#> 1544 controllerType=0 controllerNumber=1 scan=2715           2    1
#> 1545 controllerType=0 controllerNumber=1 scan=2973           3    1
#> 1546 controllerType=0 controllerNumber=1 scan=5850           2    1
#> 1547 controllerType=0 controllerNumber=1 scan=3769           4    1
#> 1548 controllerType=0 controllerNumber=1 scan=6251           4    1
#> 1549 controllerType=0 controllerNumber=1 scan=7503           3    1
#> 1550 controllerType=0 controllerNumber=1 scan=5496           2    1
#> 1551 controllerType=0 controllerNumber=1 scan=1448           3    1
#> 1552 controllerType=0 controllerNumber=1 scan=1448           3    2
#> 1553 controllerType=0 controllerNumber=1 scan=5061           3    1
#> 1554 controllerType=0 controllerNumber=1 scan=1374           4    1
#> 1555 controllerType=0 controllerNumber=1 scan=1374           4    1
#> 1556 controllerType=0 controllerNumber=1 scan=1374           4    1
#> 1557 controllerType=0 controllerNumber=1 scan=1374           4    1
#> 1558 controllerType=0 controllerNumber=1 scan=1374           4    2
#> 1559 controllerType=0 controllerNumber=1 scan=6419           4    1
#> 1560 controllerType=0 controllerNumber=1 scan=6312           2    1
#> 1561 controllerType=0 controllerNumber=1 scan=5704           3    1
#> 1562 controllerType=0 controllerNumber=1 scan=5487           4    1
#> 1563 controllerType=0 controllerNumber=1 scan=1338           2    1
#> 1564 controllerType=0 controllerNumber=1 scan=4687           4    1
#> 1565 controllerType=0 controllerNumber=1 scan=4048           3    1
#> 1566 controllerType=0 controllerNumber=1 scan=3433           2    1
#> 1567 controllerType=0 controllerNumber=1 scan=3433           2    2
#> 1568 controllerType=0 controllerNumber=1 scan=4001           3    1
#> 1569 controllerType=0 controllerNumber=1 scan=2111           2    1
#> 1570 controllerType=0 controllerNumber=1 scan=6181           4    1
#> 1571 controllerType=0 controllerNumber=1 scan=3691           2    1
#> 1572 controllerType=0 controllerNumber=1 scan=2792           2    1
#> 1573 controllerType=0 controllerNumber=1 scan=5608           2    1
#> 1574 controllerType=0 controllerNumber=1 scan=6696           2    1
#> 1575 controllerType=0 controllerNumber=1 scan=6074           3    1
#> 1576 controllerType=0 controllerNumber=1 scan=5732           2    1
#> 1577 controllerType=0 controllerNumber=1 scan=5270           4    1
#> 1578 controllerType=0 controllerNumber=1 scan=1276           2    1
#> 1579 controllerType=0 controllerNumber=1 scan=1524           2    1
#> 1580 controllerType=0 controllerNumber=1 scan=4608           4    1
#> 1581 controllerType=0 controllerNumber=1 scan=6031           2    1
#> 1582 controllerType=0 controllerNumber=1 scan=4867           3    1
#> 1583 controllerType=0 controllerNumber=1 scan=3578           2    1
#> 1584 controllerType=0 controllerNumber=1 scan=2777           2    1
#> 1585 controllerType=0 controllerNumber=1 scan=6835           2    1
#> 1586 controllerType=0 controllerNumber=1 scan=6041           4    1
#> 1587 controllerType=0 controllerNumber=1 scan=5605           3    1
#> 1588 controllerType=0 controllerNumber=1 scan=3539           2    1
#> 1589 controllerType=0 controllerNumber=1 scan=4982           2    1
#> 1590 controllerType=0 controllerNumber=1 scan=5493           2    1
#> 1591 controllerType=0 controllerNumber=1 scan=4862           3    1
#> 1592 controllerType=0 controllerNumber=1 scan=4862           3    2
#> 1593 controllerType=0 controllerNumber=1 scan=6361           3    1
#> 1594 controllerType=0 controllerNumber=1 scan=3816           3    1
#> 1595 controllerType=0 controllerNumber=1 scan=5290           3    1
#> 1596 controllerType=0 controllerNumber=1 scan=2381           2    1
#> 1597 controllerType=0 controllerNumber=1 scan=7060           2    1
#> 1598 controllerType=0 controllerNumber=1 scan=4052           3    1
#> 1599 controllerType=0 controllerNumber=1 scan=6152           3    1
#> 1600 controllerType=0 controllerNumber=1 scan=5424           3    1
#> 1601 controllerType=0 controllerNumber=1 scan=2648           4    1
#> 1602 controllerType=0 controllerNumber=1 scan=4272           3    2
#> 1603 controllerType=0 controllerNumber=1 scan=6157           2    1
#> 1604 controllerType=0 controllerNumber=1 scan=6119           2    1
#> 1605 controllerType=0 controllerNumber=1 scan=3550           2    1
#> 1606 controllerType=0 controllerNumber=1 scan=7374           2    1
#> 1607 controllerType=0 controllerNumber=1 scan=3411           2    1
#> 1608 controllerType=0 controllerNumber=1 scan=1369           3    2
#> 1609 controllerType=0 controllerNumber=1 scan=3971           2    1
#> 1610 controllerType=0 controllerNumber=1 scan=6879           2    1
#> 1611 controllerType=0 controllerNumber=1 scan=7306           2    1
#> 1612 controllerType=0 controllerNumber=1 scan=6895           2    1
#> 1613 controllerType=0 controllerNumber=1 scan=1572           3    1
#> 1614 controllerType=0 controllerNumber=1 scan=7345           2    1
#> 1615 controllerType=0 controllerNumber=1 scan=2316           2    1
#> 1616 controllerType=0 controllerNumber=1 scan=6000           3    1
#> 1617 controllerType=0 controllerNumber=1 scan=5356           3    1
#> 1618 controllerType=0 controllerNumber=1 scan=6787           3    1
#> 1619 controllerType=0 controllerNumber=1 scan=2933           2    1
#> 1620 controllerType=0 controllerNumber=1 scan=5292           3    1
#> 1621 controllerType=0 controllerNumber=1 scan=5636           3    1
#> 1622 controllerType=0 controllerNumber=1 scan=2205           3    1
#> 1623 controllerType=0 controllerNumber=1 scan=2813           2    1
#> 1624 controllerType=0 controllerNumber=1 scan=5435           2    1
#> 1625 controllerType=0 controllerNumber=1 scan=4761           2    1
#> 1626 controllerType=0 controllerNumber=1 scan=2043           2    1
#> 1627 controllerType=0 controllerNumber=1 scan=1161           2    1
#> 1628 controllerType=0 controllerNumber=1 scan=1264           2    1
#> 1629 controllerType=0 controllerNumber=1 scan=3143           3    1
#> 1630 controllerType=0 controllerNumber=1 scan=1443           2    1
#> 1631 controllerType=0 controllerNumber=1 scan=6454           3    1
#> 1632 controllerType=0 controllerNumber=1 scan=5483           3    1
#> 1633 controllerType=0 controllerNumber=1 scan=2216           2    1
#> 1634 controllerType=0 controllerNumber=1 scan=2216           2    1
#> 1635 controllerType=0 controllerNumber=1 scan=3341           3    1
#> 1636 controllerType=0 controllerNumber=1 scan=6258           2    1
#> 1637  controllerType=0 controllerNumber=1 scan=989           3    1
#> 1638 controllerType=0 controllerNumber=1 scan=6155           3    1
#> 1639 controllerType=0 controllerNumber=1 scan=1758           2    1
#> 1640 controllerType=0 controllerNumber=1 scan=5993           3    1
#> 1641 controllerType=0 controllerNumber=1 scan=4818           3    1
#> 1642 controllerType=0 controllerNumber=1 scan=6297           2    1
#> 1643 controllerType=0 controllerNumber=1 scan=6540           2    1
#> 1644 controllerType=0 controllerNumber=1 scan=2996           3    1
#> 1645 controllerType=0 controllerNumber=1 scan=2305           2    1
#> 1646 controllerType=0 controllerNumber=1 scan=5312           3    1
#> 1647 controllerType=0 controllerNumber=1 scan=1525           2    1
#> 1648 controllerType=0 controllerNumber=1 scan=3515           3    1
#> 1649 controllerType=0 controllerNumber=1 scan=7107           3    1
#> 1650 controllerType=0 controllerNumber=1 scan=1560           2    1
#> 1651 controllerType=0 controllerNumber=1 scan=1107           2    1
#> 1652 controllerType=0 controllerNumber=1 scan=1657           2    1
#> 1653 controllerType=0 controllerNumber=1 scan=5769           3    1
#> 1654 controllerType=0 controllerNumber=1 scan=5708           2    1
#> 1655 controllerType=0 controllerNumber=1 scan=5307           3    1
#> 1656 controllerType=0 controllerNumber=1 scan=1138           3    1
#> 1657 controllerType=0 controllerNumber=1 scan=3718           3    1
#> 1658 controllerType=0 controllerNumber=1 scan=3169           2    1
#> 1659 controllerType=0 controllerNumber=1 scan=1309           2    1
#> 1660 controllerType=0 controllerNumber=1 scan=4342           3    1
#> 1661 controllerType=0 controllerNumber=1 scan=4071           3    1
#> 1662 controllerType=0 controllerNumber=1 scan=4841           2    1
#> 1663 controllerType=0 controllerNumber=1 scan=5385           3    1
#> 1664 controllerType=0 controllerNumber=1 scan=3763           3    1
#> 1665 controllerType=0 controllerNumber=1 scan=2663           2    1
#> 1666 controllerType=0 controllerNumber=1 scan=2674           3    1
#> 1667 controllerType=0 controllerNumber=1 scan=1471           3    1
#> 1668 controllerType=0 controllerNumber=1 scan=4514           3    1
#> 1669 controllerType=0 controllerNumber=1 scan=6398           3    1
#> 1670 controllerType=0 controllerNumber=1 scan=2926           2    1
#> 1671 controllerType=0 controllerNumber=1 scan=1429           3    1
#> 1672 controllerType=0 controllerNumber=1 scan=3551           3    1
#> 1673 controllerType=0 controllerNumber=1 scan=5789           2    1
#> 1674 controllerType=0 controllerNumber=1 scan=3273           3    1
#> 1675 controllerType=0 controllerNumber=1 scan=5174           3    1
#> 1676 controllerType=0 controllerNumber=1 scan=4218           3    1
#> 1677 controllerType=0 controllerNumber=1 scan=6171           4    1
#> 1678 controllerType=0 controllerNumber=1 scan=4223           3    1
#> 1679 controllerType=0 controllerNumber=1 scan=1124           2    1
#> 1680 controllerType=0 controllerNumber=1 scan=4657           3    1
#> 1681 controllerType=0 controllerNumber=1 scan=5793           2    1
#> 1682 controllerType=0 controllerNumber=1 scan=3501           2    1
#> 1683 controllerType=0 controllerNumber=1 scan=5418           2    1
#> 1684 controllerType=0 controllerNumber=1 scan=5193           3    1
#> 1685 controllerType=0 controllerNumber=1 scan=5193           3    2
#> 1686 controllerType=0 controllerNumber=1 scan=6260           4    1
#> 1687 controllerType=0 controllerNumber=1 scan=5870           4    1
#> 1688 controllerType=0 controllerNumber=1 scan=4964           2    1
#> 1689 controllerType=0 controllerNumber=1 scan=5094           3    1
#> 1690 controllerType=0 controllerNumber=1 scan=5127           4    1
#> 1691 controllerType=0 controllerNumber=1 scan=3271           3    1
#> 1692 controllerType=0 controllerNumber=1 scan=6500           3    1
#> 1693 controllerType=0 controllerNumber=1 scan=5959           3    1
#> 1694 controllerType=0 controllerNumber=1 scan=4804           2    1
#> 1695 controllerType=0 controllerNumber=1 scan=5453           3    1
#> 1696 controllerType=0 controllerNumber=1 scan=5261           2    1
#> 1697 controllerType=0 controllerNumber=1 scan=4034           2    1
#> 1698 controllerType=0 controllerNumber=1 scan=3382           3    1
#> 1699 controllerType=0 controllerNumber=1 scan=5751           4    1
#> 1700 controllerType=0 controllerNumber=1 scan=5350           3    1
#> 1701 controllerType=0 controllerNumber=1 scan=3523           4    1
#> 1702 controllerType=0 controllerNumber=1 scan=4949           3    1
#> 1703 controllerType=0 controllerNumber=1 scan=3903           2    1
#> 1704 controllerType=0 controllerNumber=1 scan=1382           2    1
#> 1705 controllerType=0 controllerNumber=1 scan=5301           4    1
#> 1706 controllerType=0 controllerNumber=1 scan=5998           4    1
#> 1707 controllerType=0 controllerNumber=1 scan=3307           2    1
#> 1708 controllerType=0 controllerNumber=1 scan=6477           2    1
#> 1709 controllerType=0 controllerNumber=1 scan=4792           2    1
#> 1710 controllerType=0 controllerNumber=1 scan=5587           2    1
#> 1711 controllerType=0 controllerNumber=1 scan=5881           3    1
#> 1712 controllerType=0 controllerNumber=1 scan=3077           2    1
#> 1713 controllerType=0 controllerNumber=1 scan=4601           3    1
#> 1714 controllerType=0 controllerNumber=1 scan=6314           4    1
#> 1715 controllerType=0 controllerNumber=1 scan=7300           2    1
#> 1716 controllerType=0 controllerNumber=1 scan=5687           2    1
#> 1717 controllerType=0 controllerNumber=1 scan=2803           2    1
#> 1718 controllerType=0 controllerNumber=1 scan=6345           3    1
#> 1719 controllerType=0 controllerNumber=1 scan=4044           3    1
#> 1720 controllerType=0 controllerNumber=1 scan=5279           3    1
#> 1721 controllerType=0 controllerNumber=1 scan=5903           3    1
#> 1722 controllerType=0 controllerNumber=1 scan=4120           2    1
#> 1723 controllerType=0 controllerNumber=1 scan=1052           2    1
#> 1724 controllerType=0 controllerNumber=1 scan=3560           2    1
#> 1725 controllerType=0 controllerNumber=1 scan=1141           2    1
#> 1726 controllerType=0 controllerNumber=1 scan=5661           2    1
#> 1727 controllerType=0 controllerNumber=1 scan=5965           3    1
#> 1728 controllerType=0 controllerNumber=1 scan=2221           2    1
#> 1729 controllerType=0 controllerNumber=1 scan=5622           2    1
#> 1730 controllerType=0 controllerNumber=1 scan=2772           4    1
#> 1731 controllerType=0 controllerNumber=1 scan=7208           2    1
#> 1732 controllerType=0 controllerNumber=1 scan=4025           3    1
#> 1733 controllerType=0 controllerNumber=1 scan=1552           2    1
#> 1734 controllerType=0 controllerNumber=1 scan=6671           2    1
#> 1735 controllerType=0 controllerNumber=1 scan=4462           2    1
#> 1736 controllerType=0 controllerNumber=1 scan=5858           4    1
#> 1737 controllerType=0 controllerNumber=1 scan=5765           3    1
#> 1738 controllerType=0 controllerNumber=1 scan=4110           2    1
#> 1739 controllerType=0 controllerNumber=1 scan=5345           4    1
#> 1740  controllerType=0 controllerNumber=1 scan=958           4    1
#> 1741 controllerType=0 controllerNumber=1 scan=4684           3    1
#> 1742 controllerType=0 controllerNumber=1 scan=5719           3    1
#> 1743 controllerType=0 controllerNumber=1 scan=6985           2    1
#> 1744 controllerType=0 controllerNumber=1 scan=5569           4    1
#> 1745 controllerType=0 controllerNumber=1 scan=5078           2    1
#> 1746 controllerType=0 controllerNumber=1 scan=1647           2    1
#> 1747 controllerType=0 controllerNumber=1 scan=2981           3    1
#> 1748 controllerType=0 controllerNumber=1 scan=4454           3    1
#> 1749 controllerType=0 controllerNumber=1 scan=6428           4    1
#> 1750 controllerType=0 controllerNumber=1 scan=5066           2    1
#> 1751 controllerType=0 controllerNumber=1 scan=4378           2    1
#> 1752 controllerType=0 controllerNumber=1 scan=2848           2    1
#> 1753 controllerType=0 controllerNumber=1 scan=5331           2    1
#> 1754 controllerType=0 controllerNumber=1 scan=5331           2    1
#> 1755 controllerType=0 controllerNumber=1 scan=3224           3    1
#> 1756 controllerType=0 controllerNumber=1 scan=1460           3    1
#> 1757 controllerType=0 controllerNumber=1 scan=1683           3    1
#> 1758 controllerType=0 controllerNumber=1 scan=1597           2    1
#> 1759 controllerType=0 controllerNumber=1 scan=4638           3    1
#> 1760 controllerType=0 controllerNumber=1 scan=6053           2    1
#> 1761 controllerType=0 controllerNumber=1 scan=6302           2    1
#> 1762 controllerType=0 controllerNumber=1 scan=3750           2    1
#> 1763 controllerType=0 controllerNumber=1 scan=1219           2    1
#> 1764 controllerType=0 controllerNumber=1 scan=5164           3    1
#> 1765 controllerType=0 controllerNumber=1 scan=4376           3    1
#> 1766 controllerType=0 controllerNumber=1 scan=1417           2    1
#> 1767 controllerType=0 controllerNumber=1 scan=6106           4    1
#> 1768 controllerType=0 controllerNumber=1 scan=2635           3    1
#> 1769 controllerType=0 controllerNumber=1 scan=5086           2    1
#> 1770 controllerType=0 controllerNumber=1 scan=6374           4    1
#> 1771 controllerType=0 controllerNumber=1 scan=1899           2    1
#> 1772 controllerType=0 controllerNumber=1 scan=7226           3    1
#> 1773 controllerType=0 controllerNumber=1 scan=6466           2    1
#> 1774 controllerType=0 controllerNumber=1 scan=4872           2    1
#> 1775 controllerType=0 controllerNumber=1 scan=5494           3    1
#> 1776 controllerType=0 controllerNumber=1 scan=6950           2    1
#> 1777 controllerType=0 controllerNumber=1 scan=1711           2    1
#> 1778 controllerType=0 controllerNumber=1 scan=4925           3    1
#> 1779 controllerType=0 controllerNumber=1 scan=5031           3    1
#> 1780 controllerType=0 controllerNumber=1 scan=4244           2    1
#> 1781 controllerType=0 controllerNumber=1 scan=2140           2    1
#> 1782 controllerType=0 controllerNumber=1 scan=3097           2    1
#> 1783 controllerType=0 controllerNumber=1 scan=4134           4    1
#> 1784 controllerType=0 controllerNumber=1 scan=3562           2    1
#> 1785 controllerType=0 controllerNumber=1 scan=4783           2    1
#> 1786 controllerType=0 controllerNumber=1 scan=5328           3    1
#> 1787 controllerType=0 controllerNumber=1 scan=4124           3    1
#> 1788 controllerType=0 controllerNumber=1 scan=6487           3    1
#> 1789 controllerType=0 controllerNumber=1 scan=1650           2    1
#> 1790 controllerType=0 controllerNumber=1 scan=4418           3    1
#> 1791 controllerType=0 controllerNumber=1 scan=5211           3    1
#> 1792 controllerType=0 controllerNumber=1 scan=5986           2    1
#> 1793 controllerType=0 controllerNumber=1 scan=4439           2    1
#> 1794 controllerType=0 controllerNumber=1 scan=1507           3    1
#> 1795 controllerType=0 controllerNumber=1 scan=4087           3    1
#> 1796 controllerType=0 controllerNumber=1 scan=4785           2    2
#> 1797 controllerType=0 controllerNumber=1 scan=5256           2    1
#> 1798 controllerType=0 controllerNumber=1 scan=3825           3    1
#> 1799 controllerType=0 controllerNumber=1 scan=1908           3    1
#> 1800 controllerType=0 controllerNumber=1 scan=1275           3    1
#> 1801 controllerType=0 controllerNumber=1 scan=5529           3    1
#> 1802 controllerType=0 controllerNumber=1 scan=6550           2    1
#> 1803 controllerType=0 controllerNumber=1 scan=7131           2    1
#> 1804 controllerType=0 controllerNumber=1 scan=1288           2    1
#> 1805 controllerType=0 controllerNumber=1 scan=2373           2    1
#> 1806 controllerType=0 controllerNumber=1 scan=3437           3    1
#> 1807 controllerType=0 controllerNumber=1 scan=5012           3    2
#> 1808 controllerType=0 controllerNumber=1 scan=2349           2    1
#> 1809 controllerType=0 controllerNumber=1 scan=6028           2    1
#> 1810 controllerType=0 controllerNumber=1 scan=2199           3    1
#> 1811 controllerType=0 controllerNumber=1 scan=1536           3    1
#> 1812 controllerType=0 controllerNumber=1 scan=2498           2    1
#> 1813 controllerType=0 controllerNumber=1 scan=5325           2    1
#> 1814 controllerType=0 controllerNumber=1 scan=3161           3    1
#> 1815 controllerType=0 controllerNumber=1 scan=6750           2    1
#> 1816 controllerType=0 controllerNumber=1 scan=6750           2    2
#> 1817 controllerType=0 controllerNumber=1 scan=3862           2    1
#> 1818 controllerType=0 controllerNumber=1 scan=5021           3    1
#> 1819 controllerType=0 controllerNumber=1 scan=4904           3    1
#> 1820 controllerType=0 controllerNumber=1 scan=1605           2    1
#> 1821 controllerType=0 controllerNumber=1 scan=1415           2    1
#> 1822 controllerType=0 controllerNumber=1 scan=2560           2    1
#> 1823 controllerType=0 controllerNumber=1 scan=4177           2    1
#> 1824 controllerType=0 controllerNumber=1 scan=3494           3    1
#> 1825 controllerType=0 controllerNumber=1 scan=4220           3    1
#> 1826 controllerType=0 controllerNumber=1 scan=1931           2    1
#> 1827 controllerType=0 controllerNumber=1 scan=2641           2    1
#> 1828 controllerType=0 controllerNumber=1 scan=6846           2    1
#> 1829 controllerType=0 controllerNumber=1 scan=2727           2    1
#> 1830 controllerType=0 controllerNumber=1 scan=5707           3    1
#> 1831 controllerType=0 controllerNumber=1 scan=4125           3    1
#> 1832 controllerType=0 controllerNumber=1 scan=4296           3    1
#> 1833 controllerType=0 controllerNumber=1 scan=3598           2    1
#> 1834 controllerType=0 controllerNumber=1 scan=5924           3    1
#> 1835 controllerType=0 controllerNumber=1 scan=2193           2    1
#> 1836 controllerType=0 controllerNumber=1 scan=4122           3    1
#> 1837 controllerType=0 controllerNumber=1 scan=2421           4    1
#> 1838 controllerType=0 controllerNumber=1 scan=2421           4    1
#> 1839 controllerType=0 controllerNumber=1 scan=4912           3    1
#> 1840 controllerType=0 controllerNumber=1 scan=6165           3    1
#> 1841 controllerType=0 controllerNumber=1 scan=4924           2    1
#> 1842 controllerType=0 controllerNumber=1 scan=1482           3    1
#> 1843 controllerType=0 controllerNumber=1 scan=5584           3    1
#> 1844 controllerType=0 controllerNumber=1 scan=5401           2    1
#> 1845 controllerType=0 controllerNumber=1 scan=6103           3    1
#> 1846 controllerType=0 controllerNumber=1 scan=4275           3    1
#> 1847 controllerType=0 controllerNumber=1 scan=4056           2    1
#> 1848 controllerType=0 controllerNumber=1 scan=1162           2    1
#> 1849 controllerType=0 controllerNumber=1 scan=3846           2    1
#> 1850 controllerType=0 controllerNumber=1 scan=5796           4    1
#> 1851 controllerType=0 controllerNumber=1 scan=3977           2    1
#> 1852 controllerType=0 controllerNumber=1 scan=1898           2    1
#> 1853 controllerType=0 controllerNumber=1 scan=5198           4    1
#> 1854 controllerType=0 controllerNumber=1 scan=1584           2    1
#> 1855 controllerType=0 controllerNumber=1 scan=4469           3    1
#> 1856 controllerType=0 controllerNumber=1 scan=6107           3    1
#> 1857 controllerType=0 controllerNumber=1 scan=4388           3    1
#> 1858 controllerType=0 controllerNumber=1 scan=5792           3    1
#> 1859 controllerType=0 controllerNumber=1 scan=6110           2    1
#> 1860 controllerType=0 controllerNumber=1 scan=6797           3    1
#> 1861 controllerType=0 controllerNumber=1 scan=5977           3    1
#> 1862 controllerType=0 controllerNumber=1 scan=3596           2    1
#> 1863 controllerType=0 controllerNumber=1 scan=5405           3    1
#> 1864 controllerType=0 controllerNumber=1 scan=4849           2    1
#> 1865 controllerType=0 controllerNumber=1 scan=4849           2    1
#> 1866 controllerType=0 controllerNumber=1 scan=4447           2    1
#> 1867 controllerType=0 controllerNumber=1 scan=4957           3    1
#> 1868 controllerType=0 controllerNumber=1 scan=6631           2    1
#> 1869 controllerType=0 controllerNumber=1 scan=2968           2    1
#> 1870 controllerType=0 controllerNumber=1 scan=4797           2    1
#> 1871 controllerType=0 controllerNumber=1 scan=6196           2    1
#> 1872 controllerType=0 controllerNumber=1 scan=6235           2    1
#> 1873 controllerType=0 controllerNumber=1 scan=2909           2    1
#> 1874 controllerType=0 controllerNumber=1 scan=6013           2    1
#> 1875 controllerType=0 controllerNumber=1 scan=4799           2    1
#> 1876 controllerType=0 controllerNumber=1 scan=2102           2    1
#> 1877 controllerType=0 controllerNumber=1 scan=4450           3    1
#> 1878 controllerType=0 controllerNumber=1 scan=1889           2    1
#> 1879 controllerType=0 controllerNumber=1 scan=6376           3    1
#> 1880 controllerType=0 controllerNumber=1 scan=5088           3    1
#> 1881 controllerType=0 controllerNumber=1 scan=2782           3    1
#> 1882 controllerType=0 controllerNumber=1 scan=1468           2    1
#> 1883 controllerType=0 controllerNumber=1 scan=5511           3    1
#> 1884 controllerType=0 controllerNumber=1 scan=5772           3    1
#> 1885 controllerType=0 controllerNumber=1 scan=5802           2    1
#> 1886 controllerType=0 controllerNumber=1 scan=3978           2    1
#> 1887 controllerType=0 controllerNumber=1 scan=2915           3    1
#> 1888 controllerType=0 controllerNumber=1 scan=6012           2    1
#> 1889 controllerType=0 controllerNumber=1 scan=7489           2    1
#> 1890 controllerType=0 controllerNumber=1 scan=2452           2    1
#> 1891 controllerType=0 controllerNumber=1 scan=4021           3    1
#> 1892 controllerType=0 controllerNumber=1 scan=6243           3    1
#> 1893 controllerType=0 controllerNumber=1 scan=4591           2    1
#> 1894 controllerType=0 controllerNumber=1 scan=1342           2    1
#> 1895 controllerType=0 controllerNumber=1 scan=5543           3    1
#> 1896 controllerType=0 controllerNumber=1 scan=2508           2    1
#> 1897 controllerType=0 controllerNumber=1 scan=2346           2    1
#> 1898 controllerType=0 controllerNumber=1 scan=5309           2    1
#> 1899 controllerType=0 controllerNumber=1 scan=2770           2    1
#> 1900 controllerType=0 controllerNumber=1 scan=7314           2    1
#> 1901 controllerType=0 controllerNumber=1 scan=2681           3    1
#> 1902 controllerType=0 controllerNumber=1 scan=4005           2    1
#> 1903 controllerType=0 controllerNumber=1 scan=1608           2    1
#> 1904 controllerType=0 controllerNumber=1 scan=5431           4    2
#> 1905 controllerType=0 controllerNumber=1 scan=2391           3    1
#> 1906 controllerType=0 controllerNumber=1 scan=1491           4    1
#> 1907 controllerType=0 controllerNumber=1 scan=5815           3    1
#> 1908 controllerType=0 controllerNumber=1 scan=2457           2    1
#> 1909 controllerType=0 controllerNumber=1 scan=4328           3    1
#> 1910 controllerType=0 controllerNumber=1 scan=4111           2    1
#> 1911 controllerType=0 controllerNumber=1 scan=3790           2    1
#> 1912 controllerType=0 controllerNumber=1 scan=5428           3    1
#> 1913 controllerType=0 controllerNumber=1 scan=2355           2    1
#> 1914 controllerType=0 controllerNumber=1 scan=2274           3    1
#> 1915 controllerType=0 controllerNumber=1 scan=2726           2    1
#> 1916 controllerType=0 controllerNumber=1 scan=6254           3    1
#> 1917 controllerType=0 controllerNumber=1 scan=5635           2    1
#> 1918 controllerType=0 controllerNumber=1 scan=6127           4    1
#> 1919 controllerType=0 controllerNumber=1 scan=3779           3    1
#> 1920 controllerType=0 controllerNumber=1 scan=1926           2    1
#> 1921 controllerType=0 controllerNumber=1 scan=3337           2    1
#> 1922 controllerType=0 controllerNumber=1 scan=2449           2    1
#> 1923 controllerType=0 controllerNumber=1 scan=1164           3    1
#> 1924 controllerType=0 controllerNumber=1 scan=6441           2    1
#> 1925 controllerType=0 controllerNumber=1 scan=5369           4    1
#> 1926 controllerType=0 controllerNumber=1 scan=6605           3    1
#> 1927 controllerType=0 controllerNumber=1 scan=5860           3    1
#> 1928 controllerType=0 controllerNumber=1 scan=5121           3    1
#> 1929 controllerType=0 controllerNumber=1 scan=1261           2    1
#> 1930 controllerType=0 controllerNumber=1 scan=3519           3    1
#> 1931 controllerType=0 controllerNumber=1 scan=4022           3    1
#> 1932 controllerType=0 controllerNumber=1 scan=5731           3    1
#> 1933 controllerType=0 controllerNumber=1 scan=6871           2    1
#> 1934 controllerType=0 controllerNumber=1 scan=6856           2    1
#> 1935 controllerType=0 controllerNumber=1 scan=4891           2    2
#> 1936 controllerType=0 controllerNumber=1 scan=4788           4    1
#> 1937 controllerType=0 controllerNumber=1 scan=5931           4    1
#> 1938 controllerType=0 controllerNumber=1 scan=4621           3    1
#> 1939 controllerType=0 controllerNumber=1 scan=5011           2    1
#> 1940 controllerType=0 controllerNumber=1 scan=4781           3    1
#> 1941 controllerType=0 controllerNumber=1 scan=5946           2    1
#> 1942 controllerType=0 controllerNumber=1 scan=5318           3    1
#> 1943 controllerType=0 controllerNumber=1 scan=6963           3    1
#> 1944 controllerType=0 controllerNumber=1 scan=5421           2    1
#> 1945 controllerType=0 controllerNumber=1 scan=4012           2    1
#> 1946 controllerType=0 controllerNumber=1 scan=5675           2    1
#> 1947 controllerType=0 controllerNumber=1 scan=7506           3    1
#> 1948 controllerType=0 controllerNumber=1 scan=1191           2    1
#> 1949 controllerType=0 controllerNumber=1 scan=1253           3    1
#> 1950 controllerType=0 controllerNumber=1 scan=1670           2    1
#> 1951 controllerType=0 controllerNumber=1 scan=6050           3    1
#> 1952 controllerType=0 controllerNumber=1 scan=2628           2    1
#> 1953 controllerType=0 controllerNumber=1 scan=7196           3    1
#> 1954 controllerType=0 controllerNumber=1 scan=2539           2    1
#> 1955 controllerType=0 controllerNumber=1 scan=6570           2    1
#> 1956 controllerType=0 controllerNumber=1 scan=2630           2    1
#> 1957 controllerType=0 controllerNumber=1 scan=6875           2    1
#> 1958 controllerType=0 controllerNumber=1 scan=2337           3    1
#> 1959 controllerType=0 controllerNumber=1 scan=3890           3    1
#> 1960 controllerType=0 controllerNumber=1 scan=3814           2    1
#> 1961 controllerType=0 controllerNumber=1 scan=1882           2    1
#> 1962 controllerType=0 controllerNumber=1 scan=1590           2    1
#> 1963 controllerType=0 controllerNumber=1 scan=3187           2    1
#> 1964 controllerType=0 controllerNumber=1 scan=6058           3    1
#> 1965 controllerType=0 controllerNumber=1 scan=4778           2    1
#> 1966 controllerType=0 controllerNumber=1 scan=3782           3    1
#> 1967 controllerType=0 controllerNumber=1 scan=5430           3    1
#> 1968 controllerType=0 controllerNumber=1 scan=1454           2    1
#> 1969 controllerType=0 controllerNumber=1 scan=3818           2    1
#> 1970 controllerType=0 controllerNumber=1 scan=1108           2    1
#> 1971 controllerType=0 controllerNumber=1 scan=6448           3    1
#> 1972 controllerType=0 controllerNumber=1 scan=4466           2    1
#> 1973 controllerType=0 controllerNumber=1 scan=6168           3    1
#> 1974 controllerType=0 controllerNumber=1 scan=2414           2    1
#> 1975 controllerType=0 controllerNumber=1 scan=7232           2    1
#> 1976 controllerType=0 controllerNumber=1 scan=4652           3    1
#> 1977 controllerType=0 controllerNumber=1 scan=1694           2    1
#> 1978 controllerType=0 controllerNumber=1 scan=4888           2    1
#> 1979 controllerType=0 controllerNumber=1 scan=1329           2    1
#> 1980 controllerType=0 controllerNumber=1 scan=1329           2    2
#> 1981 controllerType=0 controllerNumber=1 scan=4335           3    1
#> 1982 controllerType=0 controllerNumber=1 scan=3534           3    1
#> 1983 controllerType=0 controllerNumber=1 scan=3348           4    1
#> 1984 controllerType=0 controllerNumber=1 scan=3348           4    2
#> 1985 controllerType=0 controllerNumber=1 scan=3024           2    1
#> 1986 controllerType=0 controllerNumber=1 scan=4631           4    1
#> 1987 controllerType=0 controllerNumber=1 scan=1293           2    1
#> 1988 controllerType=0 controllerNumber=1 scan=5015           3    1
#> 1989 controllerType=0 controllerNumber=1 scan=5313           3    1
#> 1990 controllerType=0 controllerNumber=1 scan=1256           2    1
#> 1991 controllerType=0 controllerNumber=1 scan=2943           2    1
#> 1992 controllerType=0 controllerNumber=1 scan=6385           2    1
#> 1993 controllerType=0 controllerNumber=1 scan=4368           2    1
#> 1994 controllerType=0 controllerNumber=1 scan=4098           2    1
#> 1995 controllerType=0 controllerNumber=1 scan=5382           3    1
#> 1996 controllerType=0 controllerNumber=1 scan=3670           2    1
#> 1997 controllerType=0 controllerNumber=1 scan=1407           2    1
#> 1998 controllerType=0 controllerNumber=1 scan=6665           2    1
#> 1999 controllerType=0 controllerNumber=1 scan=4577           2    1
#> 2000 controllerType=0 controllerNumber=1 scan=4577           2    2
#> 2001 controllerType=0 controllerNumber=1 scan=3568           2    1
#> 2002 controllerType=0 controllerNumber=1 scan=6112           3    1
#> 2003 controllerType=0 controllerNumber=1 scan=1963           2    1
#> 2004  controllerType=0 controllerNumber=1 scan=955           4    1
#> 2005 controllerType=0 controllerNumber=1 scan=4586           2    1
#> 2006 controllerType=0 controllerNumber=1 scan=4401           2    1
#> 2007 controllerType=0 controllerNumber=1 scan=3061           3    1
#> 2008 controllerType=0 controllerNumber=1 scan=3041           3    1
#> 2009 controllerType=0 controllerNumber=1 scan=4590           3    1
#> 2010 controllerType=0 controllerNumber=1 scan=6055           3    1
#> 2011 controllerType=0 controllerNumber=1 scan=5377           3    1
#> 2012 controllerType=0 controllerNumber=1 scan=3945           2    1
#> 2013 controllerType=0 controllerNumber=1 scan=2540           3    1
#> 2014 controllerType=0 controllerNumber=1 scan=4845           2    1
#> 2015 controllerType=0 controllerNumber=1 scan=4845           2    1
#> 2016 controllerType=0 controllerNumber=1 scan=4845           2    1
#> 2017 controllerType=0 controllerNumber=1 scan=1765           2    1
#> 2018 controllerType=0 controllerNumber=1 scan=6644           2    1
#> 2019 controllerType=0 controllerNumber=1 scan=5762           2    1
#> 2020 controllerType=0 controllerNumber=1 scan=1279           3    1
#> 2021 controllerType=0 controllerNumber=1 scan=2057           2    1
#> 2022 controllerType=0 controllerNumber=1 scan=6467           4    1
#> 2023 controllerType=0 controllerNumber=1 scan=1352           2    1
#> 2024 controllerType=0 controllerNumber=1 scan=5999           4    1
#> 2025 controllerType=0 controllerNumber=1 scan=6190           3    1
#> 2026 controllerType=0 controllerNumber=1 scan=6206           2    1
#> 2027 controllerType=0 controllerNumber=1 scan=4542           3    1
#> 2028 controllerType=0 controllerNumber=1 scan=6134           5    1
#> 2029 controllerType=0 controllerNumber=1 scan=1481           2    1
#> 2030 controllerType=0 controllerNumber=1 scan=4775           3    1
#> 2031 controllerType=0 controllerNumber=1 scan=2473           2    1
#> 2032 controllerType=0 controllerNumber=1 scan=3361           2    1
#> 2033 controllerType=0 controllerNumber=1 scan=3361           2    2
#> 2034 controllerType=0 controllerNumber=1 scan=5101           3    1
#> 2035 controllerType=0 controllerNumber=1 scan=6298           3    1
#> 2036 controllerType=0 controllerNumber=1 scan=5504           3    1
#> 2037 controllerType=0 controllerNumber=1 scan=5475           4    1
#> 2038 controllerType=0 controllerNumber=1 scan=7212           2    1
#> 2039 controllerType=0 controllerNumber=1 scan=1045           4    1
#> 2040 controllerType=0 controllerNumber=1 scan=6238           2    1
#> 2041 controllerType=0 controllerNumber=1 scan=3972           3    1
#> 2042 controllerType=0 controllerNumber=1 scan=1349           2    1
#> 2043 controllerType=0 controllerNumber=1 scan=5060           2    1
#> 2044 controllerType=0 controllerNumber=1 scan=2518           3    1
#> 2045 controllerType=0 controllerNumber=1 scan=3384           2    1
#> 2046 controllerType=0 controllerNumber=1 scan=7153           2    1
#> 2047 controllerType=0 controllerNumber=1 scan=2776           2    1
#> 2048 controllerType=0 controllerNumber=1 scan=5892           4    1
#> 2049 controllerType=0 controllerNumber=1 scan=6522           4    1
#> 2050 controllerType=0 controllerNumber=1 scan=6472           2    1
#> 2051 controllerType=0 controllerNumber=1 scan=3988           4    1
#> 2052 controllerType=0 controllerNumber=1 scan=4123           3    1
#> 2053 controllerType=0 controllerNumber=1 scan=5775           4    1
#> 2054 controllerType=0 controllerNumber=1 scan=6496           3    1
#> 2055 controllerType=0 controllerNumber=1 scan=2231           2    1
#> 2056 controllerType=0 controllerNumber=1 scan=4766           3    1
#> 2057 controllerType=0 controllerNumber=1 scan=4917           3    1
#> 2058 controllerType=0 controllerNumber=1 scan=5883           2    1
#> 2059 controllerType=0 controllerNumber=1 scan=2018           2    1
#> 2060 controllerType=0 controllerNumber=1 scan=6457           2    1
#> 2061 controllerType=0 controllerNumber=1 scan=6068           3    1
#> 2062 controllerType=0 controllerNumber=1 scan=4068           2    1
#> 2063 controllerType=0 controllerNumber=1 scan=1297           2    1
#> 2064 controllerType=0 controllerNumber=1 scan=1371           2    1
#> 2065 controllerType=0 controllerNumber=1 scan=2590           2    1
#> 2066 controllerType=0 controllerNumber=1 scan=6154           2    1
#> 2067 controllerType=0 controllerNumber=1 scan=5451           2    1
#> 2068 controllerType=0 controllerNumber=1 scan=6073           3    1
#> 2069 controllerType=0 controllerNumber=1 scan=7274           2    1
#> 2070 controllerType=0 controllerNumber=1 scan=5108           4    1
#> 2071 controllerType=0 controllerNumber=1 scan=4641           3    1
#> 2072 controllerType=0 controllerNumber=1 scan=1427           2    1
#> 2073 controllerType=0 controllerNumber=1 scan=7013           2    1
#> 2074 controllerType=0 controllerNumber=1 scan=1207           2    1
#> 2075 controllerType=0 controllerNumber=1 scan=2854           2    1
#> 2076 controllerType=0 controllerNumber=1 scan=5949           4    1
#> 2077 controllerType=0 controllerNumber=1 scan=4550           4    1
#> 2078 controllerType=0 controllerNumber=1 scan=1239           2    1
#> 2079 controllerType=0 controllerNumber=1 scan=4341           2    1
#> 2080 controllerType=0 controllerNumber=1 scan=4341           2    2
#> 2081 controllerType=0 controllerNumber=1 scan=3438           3    1
#> 2082 controllerType=0 controllerNumber=1 scan=3218           2    1
#> 2083 controllerType=0 controllerNumber=1 scan=6815           3    1
#> 2084 controllerType=0 controllerNumber=1 scan=6237           2    1
#> 2085 controllerType=0 controllerNumber=1 scan=6237           2    1
#> 2086 controllerType=0 controllerNumber=1 scan=2030           2    1
#> 2087 controllerType=0 controllerNumber=1 scan=4433           3    1
#> 2088 controllerType=0 controllerNumber=1 scan=3828           2    1
#> 2089 controllerType=0 controllerNumber=1 scan=5787           3    1
#> 2090 controllerType=0 controllerNumber=1 scan=4357           3    1
#> 2091 controllerType=0 controllerNumber=1 scan=2507           2    1
#> 2092 controllerType=0 controllerNumber=1 scan=6083           4    1
#> 2093 controllerType=0 controllerNumber=1 scan=4084           3    1
#> 2094 controllerType=0 controllerNumber=1 scan=7497           2    1
#> 2095 controllerType=0 controllerNumber=1 scan=3014           2    1
#> 2096 controllerType=0 controllerNumber=1 scan=5955           3    1
#> 2097 controllerType=0 controllerNumber=1 scan=4540           3    1
#> 2098 controllerType=0 controllerNumber=1 scan=1227           3    1
#> 2099 controllerType=0 controllerNumber=1 scan=3426           3    1
#> 2100 controllerType=0 controllerNumber=1 scan=3303           2    1
#> 2101 controllerType=0 controllerNumber=1 scan=6525           4    1
#> 2102 controllerType=0 controllerNumber=1 scan=5554           2    1
#> 2103 controllerType=0 controllerNumber=1 scan=3662           3    1
#> 2104 controllerType=0 controllerNumber=1 scan=3733           3    1
#> 2105 controllerType=0 controllerNumber=1 scan=4386           2    1
#> 2106 controllerType=0 controllerNumber=1 scan=6900           2    1
#> 2107 controllerType=0 controllerNumber=1 scan=5259           2    1
#> 2108 controllerType=0 controllerNumber=1 scan=2271           2    1
#> 2109 controllerType=0 controllerNumber=1 scan=4148           3    1
#> 2110 controllerType=0 controllerNumber=1 scan=3235           3    1
#> 2111 controllerType=0 controllerNumber=1 scan=1201           2    1
#> 2112 controllerType=0 controllerNumber=1 scan=3253           2    1
#> 2113 controllerType=0 controllerNumber=1 scan=3629           2    1
#> 2114 controllerType=0 controllerNumber=1 scan=4835           4    1
#> 2115 controllerType=0 controllerNumber=1 scan=3960           3    1
#> 2116 controllerType=0 controllerNumber=1 scan=4440           2    1
#> 2117 controllerType=0 controllerNumber=1 scan=3112           2    1
#> 2118 controllerType=0 controllerNumber=1 scan=3952           2    1
#> 2119 controllerType=0 controllerNumber=1 scan=5120           3    1
#> 2120 controllerType=0 controllerNumber=1 scan=1561           2    1
#> 2121 controllerType=0 controllerNumber=1 scan=5894           2    1
#> 2122 controllerType=0 controllerNumber=1 scan=4642           2    1
#> 2123 controllerType=0 controllerNumber=1 scan=4646           4    1
#> 2124 controllerType=0 controllerNumber=1 scan=5758           3    1
#> 2125 controllerType=0 controllerNumber=1 scan=5758           3    2
#> 2126 controllerType=0 controllerNumber=1 scan=4324           2    1
#> 2127 controllerType=0 controllerNumber=1 scan=1627           2    1
#> 2128 controllerType=0 controllerNumber=1 scan=4298           3    1
#> 2129 controllerType=0 controllerNumber=1 scan=6146           2    1
#> 2130 controllerType=0 controllerNumber=1 scan=3541           3    1
#> 2131 controllerType=0 controllerNumber=1 scan=5842           3    1
#> 2132 controllerType=0 controllerNumber=1 scan=4967           3    1
#> 2133 controllerType=0 controllerNumber=1 scan=1674           2    1
#> 2134 controllerType=0 controllerNumber=1 scan=4768           2    1
#> 2135 controllerType=0 controllerNumber=1 scan=2474           2    1
#> 2136 controllerType=0 controllerNumber=1 scan=1653           2    1
#> 2137 controllerType=0 controllerNumber=1 scan=5925           4    1
#> 2138 controllerType=0 controllerNumber=1 scan=3263           2    1
#> 2139 controllerType=0 controllerNumber=1 scan=3850           2    1
#> 2140 controllerType=0 controllerNumber=1 scan=4975           3    1
#> 2141 controllerType=0 controllerNumber=1 scan=3251           4    1
#> 2142 controllerType=0 controllerNumber=1 scan=3695           3    1
#> 2143 controllerType=0 controllerNumber=1 scan=4334           3    1
#> 2144 controllerType=0 controllerNumber=1 scan=5457           3    1
#> 2145 controllerType=0 controllerNumber=1 scan=5854           2    1
#> 2146 controllerType=0 controllerNumber=1 scan=4962           4    1
#> 2147 controllerType=0 controllerNumber=1 scan=4363           3    2
#> 2148 controllerType=0 controllerNumber=1 scan=5489           2    1
#> 2149 controllerType=0 controllerNumber=1 scan=3472           2    1
#> 2150 controllerType=0 controllerNumber=1 scan=3237           2    1
#> 2151 controllerType=0 controllerNumber=1 scan=4294           3    1
#> 2152 controllerType=0 controllerNumber=1 scan=3322           3    1
#> 2153 controllerType=0 controllerNumber=1 scan=2872           2    1
#> 2154 controllerType=0 controllerNumber=1 scan=2097           2    1
#> 2155 controllerType=0 controllerNumber=1 scan=4747           3    1
#> 2156 controllerType=0 controllerNumber=1 scan=1413           2    1
#> 2157 controllerType=0 controllerNumber=1 scan=6838           2    1
#> 2158 controllerType=0 controllerNumber=1 scan=5372           2    1
#> 2159 controllerType=0 controllerNumber=1 scan=1631           2    1
#> 2160 controllerType=0 controllerNumber=1 scan=2870           2    1
#> 2161 controllerType=0 controllerNumber=1 scan=4855           2    1
#> 2162 controllerType=0 controllerNumber=1 scan=3232           2    1
#> 2163 controllerType=0 controllerNumber=1 scan=6122           2    1
#> 2164 controllerType=0 controllerNumber=1 scan=5254           3    1
#> 2165 controllerType=0 controllerNumber=1 scan=1539           3    1
#> 2166 controllerType=0 controllerNumber=1 scan=5578           2    1
#> 2167 controllerType=0 controllerNumber=1 scan=3473           3    1
#> 2168 controllerType=0 controllerNumber=1 scan=5341           2    1
#> 2169 controllerType=0 controllerNumber=1 scan=1372           3    1
#> 2170 controllerType=0 controllerNumber=1 scan=5962           3    1
#> 2171 controllerType=0 controllerNumber=1 scan=5954           3    1
#> 2172 controllerType=0 controllerNumber=1 scan=4910           2    1
#> 2173 controllerType=0 controllerNumber=1 scan=2993           3    1
#> 2174 controllerType=0 controllerNumber=1 scan=4561           2    1
#> 2175 controllerType=0 controllerNumber=1 scan=2104           3    1
#> 2176 controllerType=0 controllerNumber=1 scan=6842           2    1
#> 2177 controllerType=0 controllerNumber=1 scan=5036           3    1
#> 2178 controllerType=0 controllerNumber=1 scan=5036           3    2
#> 2179 controllerType=0 controllerNumber=1 scan=1336           2    1
#> 2180 controllerType=0 controllerNumber=1 scan=2580           2    1
#> 2181 controllerType=0 controllerNumber=1 scan=2828           3    1
#> 2182 controllerType=0 controllerNumber=1 scan=5613           3    1
#> 2183 controllerType=0 controllerNumber=1 scan=4902           3    1
#> 2184 controllerType=0 controllerNumber=1 scan=2409           2    1
#> 2185 controllerType=0 controllerNumber=1 scan=3344           2    1
#> 2186 controllerType=0 controllerNumber=1 scan=1641           2    1
#> 2187 controllerType=0 controllerNumber=1 scan=4055           2    1
#> 2188 controllerType=0 controllerNumber=1 scan=7243           2    1
#> 2189 controllerType=0 controllerNumber=1 scan=3627           2    1
#> 2190 controllerType=0 controllerNumber=1 scan=5103           3    1
#> 2191 controllerType=0 controllerNumber=1 scan=4645           3    1
#> 2192 controllerType=0 controllerNumber=1 scan=4675           2    1
#> 2193 controllerType=0 controllerNumber=1 scan=4675           2    1
#> 2194 controllerType=0 controllerNumber=1 scan=4786           2    1
#> 2195 controllerType=0 controllerNumber=1 scan=6517           4    1
#> 2196 controllerType=0 controllerNumber=1 scan=5911           3    1
#> 2197 controllerType=0 controllerNumber=1 scan=5393           4    1
#> 2198 controllerType=0 controllerNumber=1 scan=2134           2    1
#> 2199 controllerType=0 controllerNumber=1 scan=6501           2    1
#> 2200 controllerType=0 controllerNumber=1 scan=5323           3    1
#> 2201 controllerType=0 controllerNumber=1 scan=5408           3    1
#> 2202 controllerType=0 controllerNumber=1 scan=1779           3    1
#> 2203 controllerType=0 controllerNumber=1 scan=2157           3    1
#> 2204 controllerType=0 controllerNumber=1 scan=2436           2    1
#> 2205 controllerType=0 controllerNumber=1 scan=3849           2    1
#> 2206 controllerType=0 controllerNumber=1 scan=4926           2    1
#> 2207 controllerType=0 controllerNumber=1 scan=6272           2    1
#> 2208 controllerType=0 controllerNumber=1 scan=7379           2    1
#> 2209 controllerType=0 controllerNumber=1 scan=5670           3    1
#> 2210 controllerType=0 controllerNumber=1 scan=5670           3    2
#> 2211 controllerType=0 controllerNumber=1 scan=2266           2    1
#> 2212 controllerType=0 controllerNumber=1 scan=4993           2    1
#> 2213 controllerType=0 controllerNumber=1 scan=4740           2    1
#> 2214 controllerType=0 controllerNumber=1 scan=2816           2    1
#> 2215 controllerType=0 controllerNumber=1 scan=7110           2    1
#> 2216 controllerType=0 controllerNumber=1 scan=1110           3    1
#> 2217 controllerType=0 controllerNumber=1 scan=1110           3    2
#> 2218 controllerType=0 controllerNumber=1 scan=1773           2    1
#> 2219 controllerType=0 controllerNumber=1 scan=1499           2    1
#> 2220 controllerType=0 controllerNumber=1 scan=6434           3    1
#> 2221 controllerType=0 controllerNumber=1 scan=6526           3    1
#> 2222 controllerType=0 controllerNumber=1 scan=1640           2    1
#> 2223 controllerType=0 controllerNumber=1 scan=4737           2    1
#> 2224 controllerType=0 controllerNumber=1 scan=6748           4    1
#> 2225 controllerType=0 controllerNumber=1 scan=3013           2    1
#> 2226 controllerType=0 controllerNumber=1 scan=5530           3    1
#> 2227 controllerType=0 controllerNumber=1 scan=4092           2    1
#> 2228 controllerType=0 controllerNumber=1 scan=5351           3    1
#> 2229 controllerType=0 controllerNumber=1 scan=5166           3    1
#> 2230 controllerType=0 controllerNumber=1 scan=4302           2    1
#> 2231 controllerType=0 controllerNumber=1 scan=3298           3    1
#> 2232 controllerType=0 controllerNumber=1 scan=3937           4    1
#> 2233 controllerType=0 controllerNumber=1 scan=3197           2    1
#> 2234 controllerType=0 controllerNumber=1 scan=1130           3    1
#> 2235 controllerType=0 controllerNumber=1 scan=4269           2    1
#> 2236 controllerType=0 controllerNumber=1 scan=3878           3    1
#> 2237 controllerType=0 controllerNumber=1 scan=1179           2    1
#> 2238 controllerType=0 controllerNumber=1 scan=2826           2    1
#> 2239 controllerType=0 controllerNumber=1 scan=3845           3    1
#> 2240 controllerType=0 controllerNumber=1 scan=4470           4    1
#> 2241 controllerType=0 controllerNumber=1 scan=6566           2    1
#> 2242 controllerType=0 controllerNumber=1 scan=1092           3    1
#> 2243 controllerType=0 controllerNumber=1 scan=4384           3    1
#> 2244 controllerType=0 controllerNumber=1 scan=2856           2    1
#> 2245 controllerType=0 controllerNumber=1 scan=1637           3    1
#> 2246 controllerType=0 controllerNumber=1 scan=4289           3    1
#> 2247 controllerType=0 controllerNumber=1 scan=6108           2    1
#> 2248 controllerType=0 controllerNumber=1 scan=7527           2    1
#> 2249 controllerType=0 controllerNumber=1 scan=1211           2    1
#> 2250 controllerType=0 controllerNumber=1 scan=2254           2    1
#> 2251 controllerType=0 controllerNumber=1 scan=1167           2    1
#> 2252 controllerType=0 controllerNumber=1 scan=7355           2    1
#> 2253 controllerType=0 controllerNumber=1 scan=1505           2    1
#> 2254 controllerType=0 controllerNumber=1 scan=2786           2    1
#> 2255 controllerType=0 controllerNumber=1 scan=4095           3    1
#> 2256 controllerType=0 controllerNumber=1 scan=6044           3    1
#> 2257 controllerType=0 controllerNumber=1 scan=6065           3    1
#> 2258 controllerType=0 controllerNumber=1 scan=1178           3    1
#> 2259 controllerType=0 controllerNumber=1 scan=6179           3    1
#> 2260 controllerType=0 controllerNumber=1 scan=4195           3    1
#> 2261 controllerType=0 controllerNumber=1 scan=1331           2    1
#> 2262 controllerType=0 controllerNumber=1 scan=3448           2    1
#> 2263 controllerType=0 controllerNumber=1 scan=5213           2    1
#> 2264 controllerType=0 controllerNumber=1 scan=5784           4    1
#> 2265 controllerType=0 controllerNumber=1 scan=7325           2    1
#> 2266 controllerType=0 controllerNumber=1 scan=4901           3    1
#> 2267 controllerType=0 controllerNumber=1 scan=7417           2    1
#> 2268 controllerType=0 controllerNumber=1 scan=4317           3    1
#> 2269 controllerType=0 controllerNumber=1 scan=5107           2    1
#> 2270 controllerType=0 controllerNumber=1 scan=3223           2    1
#> 2271 controllerType=0 controllerNumber=1 scan=5725           2    1
#> 2272 controllerType=0 controllerNumber=1 scan=5935           3    1
#> 2273 controllerType=0 controllerNumber=1 scan=3766           3    1
#> 2274 controllerType=0 controllerNumber=1 scan=3092           2    1
#> 2275 controllerType=0 controllerNumber=1 scan=3092           2    2
#> 2276 controllerType=0 controllerNumber=1 scan=6062           3    1
#> 2277 controllerType=0 controllerNumber=1 scan=6654           3    1
#> 2278 controllerType=0 controllerNumber=1 scan=3771           2    1
#> 2279 controllerType=0 controllerNumber=1 scan=1619           3    1
#> 2280 controllerType=0 controllerNumber=1 scan=2203           2    1
#> 2281 controllerType=0 controllerNumber=1 scan=2203           2    2
#> 2282 controllerType=0 controllerNumber=1 scan=3250           3    1
#> 2283 controllerType=0 controllerNumber=1 scan=4857           2    1
#> 2284 controllerType=0 controllerNumber=1 scan=6034           3    1
#> 2285 controllerType=0 controllerNumber=1 scan=1418           3    1
#> 2286 controllerType=0 controllerNumber=1 scan=3552           2    1
#> 2287 controllerType=0 controllerNumber=1 scan=7273           2    1
#> 2288 controllerType=0 controllerNumber=1 scan=1414           3    1
#> 2289 controllerType=0 controllerNumber=1 scan=1414           3    1
#> 2290 controllerType=0 controllerNumber=1 scan=4219           3    1
#> 2291 controllerType=0 controllerNumber=1 scan=5004           3    1
#> 2292 controllerType=0 controllerNumber=1 scan=5136           2    1
#> 2293 controllerType=0 controllerNumber=1 scan=4300           3    1
#> 2294 controllerType=0 controllerNumber=1 scan=7285           3    1
#> 2295 controllerType=0 controllerNumber=1 scan=6097           3    1
#> 2296 controllerType=0 controllerNumber=1 scan=4911           3    1
#> 2297 controllerType=0 controllerNumber=1 scan=5803           3    1
#> 2298 controllerType=0 controllerNumber=1 scan=4458           2    1
#> 2299 controllerType=0 controllerNumber=1 scan=5616           3    1
#> 2300 controllerType=0 controllerNumber=1 scan=1834           2    1
#> 2301 controllerType=0 controllerNumber=1 scan=2563           2    1
#> 2302 controllerType=0 controllerNumber=1 scan=6751           2    1
#> 2303 controllerType=0 controllerNumber=1 scan=3386           2    1
#> 2304 controllerType=0 controllerNumber=1 scan=2659           3    1
#> 2305 controllerType=0 controllerNumber=1 scan=1102           4    1
#> 2306 controllerType=0 controllerNumber=1 scan=1102           4    2
#> 2307 controllerType=0 controllerNumber=1 scan=4049           3    1
#> 2308 controllerType=0 controllerNumber=1 scan=3051           2    1
#> 2309 controllerType=0 controllerNumber=1 scan=5840           2    1
#> 2310 controllerType=0 controllerNumber=1 scan=1330           2    1
#> 2311 controllerType=0 controllerNumber=1 scan=1850           2    1
#> 2312 controllerType=0 controllerNumber=1 scan=6397           2    1
#> 2313 controllerType=0 controllerNumber=1 scan=3288           2    1
#> 2314 controllerType=0 controllerNumber=1 scan=5176           2    1
#> 2315 controllerType=0 controllerNumber=1 scan=4551           3    1
#> 2316 controllerType=0 controllerNumber=1 scan=3810           2    1
#> 2317 controllerType=0 controllerNumber=1 scan=6290           2    1
#> 2318 controllerType=0 controllerNumber=1 scan=2934           2    1
#> 2319 controllerType=0 controllerNumber=1 scan=4471           3    1
#> 2320 controllerType=0 controllerNumber=1 scan=3428           2    1
#> 2321 controllerType=0 controllerNumber=1 scan=5910           3    1
#> 2322 controllerType=0 controllerNumber=1 scan=2339           3    1
#> 2323 controllerType=0 controllerNumber=1 scan=1223           2    1
#> 2324 controllerType=0 controllerNumber=1 scan=2479           3    1
#> 2325 controllerType=0 controllerNumber=1 scan=2189           2    1
#> 2326 controllerType=0 controllerNumber=1 scan=5498           2    1
#> 2327 controllerType=0 controllerNumber=1 scan=5745           2    1
#> 2328 controllerType=0 controllerNumber=1 scan=2879           2    1
#> 2329 controllerType=0 controllerNumber=1 scan=5729           3    1
#> 2330 controllerType=0 controllerNumber=1 scan=1373           2    1
#> 2331 controllerType=0 controllerNumber=1 scan=1328           2    1
#> 2332 controllerType=0 controllerNumber=1 scan=2370           3    1
#> 2333 controllerType=0 controllerNumber=1 scan=1730           2    1
#> 2334 controllerType=0 controllerNumber=1 scan=3944           3    1
#> 2335 controllerType=0 controllerNumber=1 scan=4155           3    1
#> 2336 controllerType=0 controllerNumber=1 scan=3821           2    1
#> 2337 controllerType=0 controllerNumber=1 scan=5525           3    1
#> 2338 controllerType=0 controllerNumber=1 scan=7258           3    1
#> 2339 controllerType=0 controllerNumber=1 scan=5770           3    1
#> 2340 controllerType=0 controllerNumber=1 scan=5770           3    2
#> 2341 controllerType=0 controllerNumber=1 scan=6594           3    1
#> 2342 controllerType=0 controllerNumber=1 scan=6153           4    1
#> 2343 controllerType=0 controllerNumber=1 scan=4726           2    1
#> 2344 controllerType=0 controllerNumber=1 scan=1921           2    1
#> 2345 controllerType=0 controllerNumber=1 scan=2824           2    1
#> 2346 controllerType=0 controllerNumber=1 scan=6789           2    1
#> 2347 controllerType=0 controllerNumber=1 scan=5852           2    1
#> 2348 controllerType=0 controllerNumber=1 scan=4629           2    1
#> 2349 controllerType=0 controllerNumber=1 scan=7129           2    1
#> 2350 controllerType=0 controllerNumber=1 scan=6770           2    1
#> 2351 controllerType=0 controllerNumber=1 scan=4676           2    1
#> 2352 controllerType=0 controllerNumber=1 scan=1827           2    1
#> 2353 controllerType=0 controllerNumber=1 scan=1827           2    2
#> 2354 controllerType=0 controllerNumber=1 scan=6252           2    1
#> 2355 controllerType=0 controllerNumber=1 scan=6858           2    1
#> 2356 controllerType=0 controllerNumber=1 scan=5446           4    1
#> 2357 controllerType=0 controllerNumber=1 scan=3022           2    1
#> 2358 controllerType=0 controllerNumber=1 scan=4467           3    1
#> 2359 controllerType=0 controllerNumber=1 scan=7236           2    1
#> 2360 controllerType=0 controllerNumber=1 scan=2728           2    1
#> 2361 controllerType=0 controllerNumber=1 scan=5201           2    1
#> 2362 controllerType=0 controllerNumber=1 scan=1593           2    1
#> 2363 controllerType=0 controllerNumber=1 scan=5090           3    1
#> 2364 controllerType=0 controllerNumber=1 scan=6713           2    1
#> 2365 controllerType=0 controllerNumber=1 scan=6383           2    1
#> 2366 controllerType=0 controllerNumber=1 scan=4359           2    1
#> 2367 controllerType=0 controllerNumber=1 scan=5968           3    1
#> 2368 controllerType=0 controllerNumber=1 scan=5396           2    1
#> 2369 controllerType=0 controllerNumber=1 scan=2112           3    1
#> 2370 controllerType=0 controllerNumber=1 scan=1316           3    1
#> 2371 controllerType=0 controllerNumber=1 scan=5379           2    1
#> 2372 controllerType=0 controllerNumber=1 scan=4370           3    1
#> 2373 controllerType=0 controllerNumber=1 scan=5093           2    1
#> 2374 controllerType=0 controllerNumber=1 scan=5114           3    1
#> 2375 controllerType=0 controllerNumber=1 scan=2200           3    1
#> 2376 controllerType=0 controllerNumber=1 scan=1056           3    1
#> 2377 controllerType=0 controllerNumber=1 scan=6120           3    1
#> 2378 controllerType=0 controllerNumber=1 scan=2987           2    1
#> 2379 controllerType=0 controllerNumber=1 scan=1777           4    1
#> 2380 controllerType=0 controllerNumber=1 scan=4010           3    1
#> 2381 controllerType=0 controllerNumber=1 scan=4010           3    1
#> 2382 controllerType=0 controllerNumber=1 scan=1381           3    2
#> 2383 controllerType=0 controllerNumber=1 scan=3058           4    1
#> 2384 controllerType=0 controllerNumber=1 scan=1846           2    1
#> 2385 controllerType=0 controllerNumber=1 scan=5499           3    1
#> 2386 controllerType=0 controllerNumber=1 scan=7398           2    1
#> 2387 controllerType=0 controllerNumber=1 scan=4948           2    1
#> 2388 controllerType=0 controllerNumber=1 scan=2690           3    1
#> 2389 controllerType=0 controllerNumber=1 scan=6563           2    1
#> 2390 controllerType=0 controllerNumber=1 scan=4135           3    1
#> 2391 controllerType=0 controllerNumber=1 scan=2105           2    1
#> 2392 controllerType=0 controllerNumber=1 scan=3296           2    1
#> 2393 controllerType=0 controllerNumber=1 scan=5966           2    1
#> 2394 controllerType=0 controllerNumber=1 scan=7262           3    1
#> 2395 controllerType=0 controllerNumber=1 scan=3946           3    1
#> 2396 controllerType=0 controllerNumber=1 scan=2864           2    1
#> 2397 controllerType=0 controllerNumber=1 scan=5191           4    1
#> 2398 controllerType=0 controllerNumber=1 scan=4764           2    1
#> 2399 controllerType=0 controllerNumber=1 scan=1975           2    1
#> 2400 controllerType=0 controllerNumber=1 scan=6581           2    1
#> 2401 controllerType=0 controllerNumber=1 scan=6581           2    2
#> 2402 controllerType=0 controllerNumber=1 scan=3574           3    1
#> 2403 controllerType=0 controllerNumber=1 scan=2331           2    1
#> 2404 controllerType=0 controllerNumber=1 scan=5939           3    1
#> 2405 controllerType=0 controllerNumber=1 scan=5690           3    1
#> 2406 controllerType=0 controllerNumber=1 scan=5723           2    1
#> 2407 controllerType=0 controllerNumber=1 scan=5423           3    1
#> 2408 controllerType=0 controllerNumber=1 scan=5957           3    1
#> 2409 controllerType=0 controllerNumber=1 scan=3513           2    1
#> 2410 controllerType=0 controllerNumber=1 scan=3081           2    1
#> 2411 controllerType=0 controllerNumber=1 scan=4987           3    1
#> 2412 controllerType=0 controllerNumber=1 scan=5574           4    1
#> 2413 controllerType=0 controllerNumber=1 scan=5807           3    1
#> 2414 controllerType=0 controllerNumber=1 scan=5807           3    2
#> 2415 controllerType=0 controllerNumber=1 scan=1671           2    1
#> 2416 controllerType=0 controllerNumber=1 scan=1910           2    2
#> 2417 controllerType=0 controllerNumber=1 scan=6418           2    1
#> 2418 controllerType=0 controllerNumber=1 scan=6418           2    2
#> 2419 controllerType=0 controllerNumber=1 scan=5344           3    1
#> 2420 controllerType=0 controllerNumber=1 scan=3439           3    1
#> 2421 controllerType=0 controllerNumber=1 scan=2376           2    1
#> 2422 controllerType=0 controllerNumber=1 scan=3099           2    1
#> 2423 controllerType=0 controllerNumber=1 scan=4938           2    1
#> 2424 controllerType=0 controllerNumber=1 scan=3904           2    1
#> 2425 controllerType=0 controllerNumber=1 scan=3233           2    1
#> 2426 controllerType=0 controllerNumber=1 scan=4774           3    1
#> 2427 controllerType=0 controllerNumber=1 scan=4774           3    2
#> 2428 controllerType=0 controllerNumber=1 scan=5333           4    1
#> 2429 controllerType=0 controllerNumber=1 scan=3542           3    1
#> 2430 controllerType=0 controllerNumber=1 scan=1582           2    1
#> 2431 controllerType=0 controllerNumber=1 scan=3301           2    1
#> 2432 controllerType=0 controllerNumber=1 scan=4382           2    1
#> 2433 controllerType=0 controllerNumber=1 scan=6962           3    1
#> 2434 controllerType=0 controllerNumber=1 scan=6763           3    1
#> 2435 controllerType=0 controllerNumber=1 scan=6763           3    1
#> 2436 controllerType=0 controllerNumber=1 scan=1188           3    1
#> 2437 controllerType=0 controllerNumber=1 scan=5671           2    1
#> 2438 controllerType=0 controllerNumber=1 scan=1999           2    1
#> 2439 controllerType=0 controllerNumber=1 scan=2680           2    1
#> 2440 controllerType=0 controllerNumber=1 scan=3417           2    1
#> 2441 controllerType=0 controllerNumber=1 scan=6029           4    1
#> 2442 controllerType=0 controllerNumber=1 scan=6223           3    1
#> 2443 controllerType=0 controllerNumber=1 scan=4624           2    1
#> 2444 controllerType=0 controllerNumber=1 scan=6561           2    1
#> 2445 controllerType=0 controllerNumber=1 scan=1613           2    1
#> 2446 controllerType=0 controllerNumber=1 scan=4449           3    1
#> 2447 controllerType=0 controllerNumber=1 scan=1286           2    1
#> 2448 controllerType=0 controllerNumber=1 scan=3671           2    1
#> 2449 controllerType=0 controllerNumber=1 scan=5669           3    1
#> 2450 controllerType=0 controllerNumber=1 scan=5676           2    1
#> 2451 controllerType=0 controllerNumber=1 scan=1745           2    1
#> 2452 controllerType=0 controllerNumber=1 scan=3004           2    1
#> 2453 controllerType=0 controllerNumber=1 scan=5943           3    1
#> 2454 controllerType=0 controllerNumber=1 scan=5943           3    2
#> 2455 controllerType=0 controllerNumber=1 scan=3783           3    1
#> 2456 controllerType=0 controllerNumber=1 scan=3783           3    2
#> 2457 controllerType=0 controllerNumber=1 scan=3783           3    3
#> 2458 controllerType=0 controllerNumber=1 scan=2685           2    1
#> 2459 controllerType=0 controllerNumber=1 scan=3392           2    1
#> 2460 controllerType=0 controllerNumber=1 scan=3392           2    2
#> 2461 controllerType=0 controllerNumber=1 scan=3321           2    1
#> 2462 controllerType=0 controllerNumber=1 scan=3732           2    1
#> 2463 controllerType=0 controllerNumber=1 scan=4681           3    1
#> 2464 controllerType=0 controllerNumber=1 scan=4183           3    1
#> 2465 controllerType=0 controllerNumber=1 scan=4060           3    2
#> 2466 controllerType=0 controllerNumber=1 scan=6574           4    2
#> 2467 controllerType=0 controllerNumber=1 scan=5680           3    1
#> 2468 controllerType=0 controllerNumber=1 scan=1484           3    1
#> 2469 controllerType=0 controllerNumber=1 scan=5637           2    1
#> 2470 controllerType=0 controllerNumber=1 scan=6164           3    1
#> 2471 controllerType=0 controllerNumber=1 scan=1304           3    2
#> 2472 controllerType=0 controllerNumber=1 scan=3664           2    1
#> 2473 controllerType=0 controllerNumber=1 scan=2602           2    1
#> 2474 controllerType=0 controllerNumber=1 scan=4354           2    1
#> 2475 controllerType=0 controllerNumber=1 scan=7435           2    1
#> 2476 controllerType=0 controllerNumber=1 scan=4086           2    1
#> 2477 controllerType=0 controllerNumber=1 scan=1774           2    1
#> 2478 controllerType=0 controllerNumber=1 scan=3135           2    1
#> 2479 controllerType=0 controllerNumber=1 scan=6315           4    1
#> 2480 controllerType=0 controllerNumber=1 scan=2990           2    1
#> 2481 controllerType=0 controllerNumber=1 scan=4156           2    1
#> 2482 controllerType=0 controllerNumber=1 scan=5034           2    1
#> 2483 controllerType=0 controllerNumber=1 scan=4216           2    1
#> 2484 controllerType=0 controllerNumber=1 scan=4563           3    1
#> 2485 controllerType=0 controllerNumber=1 scan=5702           3    1
#> 2486 controllerType=0 controllerNumber=1 scan=2430           2    1
#> 2487 controllerType=0 controllerNumber=1 scan=6281           2    1
#> 2488 controllerType=0 controllerNumber=1 scan=6270           4    1
#> 2489 controllerType=0 controllerNumber=1 scan=6225           3    1
#> 2490 controllerType=0 controllerNumber=1 scan=5971           3    2
#> 2491 controllerType=0 controllerNumber=1 scan=3652           2    1
#> 2492 controllerType=0 controllerNumber=1 scan=2825           3    1
#> 2493 controllerType=0 controllerNumber=1 scan=1451           2    1
#> 2494 controllerType=0 controllerNumber=1 scan=3460           2    1
#> 2495 controllerType=0 controllerNumber=1 scan=7380           2    1
#> 2496 controllerType=0 controllerNumber=1 scan=6991           2    1
#> 2497 controllerType=0 controllerNumber=1 scan=5306           3    1
#> 2498 controllerType=0 controllerNumber=1 scan=5760           3    1
#> 2499 controllerType=0 controllerNumber=1 scan=6427           3    1
#> 2500 controllerType=0 controllerNumber=1 scan=6370           4    1
#> 2501 controllerType=0 controllerNumber=1 scan=2398           2    1
#> 2502 controllerType=0 controllerNumber=1 scan=5740           3    1
#> 2503 controllerType=0 controllerNumber=1 scan=5740           3    2
#> 2504 controllerType=0 controllerNumber=1 scan=3990           3    1
#> 2505 controllerType=0 controllerNumber=1 scan=6461           3    1
#> 2506 controllerType=0 controllerNumber=1 scan=1941           2    1
#> 2507 controllerType=0 controllerNumber=1 scan=4592           2    1
#> 2508 controllerType=0 controllerNumber=1 scan=5882           2    1
#> 2509 controllerType=0 controllerNumber=1 scan=5373           3    1
#> 2510 controllerType=0 controllerNumber=1 scan=5473           2    1
#> 2511 controllerType=0 controllerNumber=1 scan=1843           2    1
#> 2512 controllerType=0 controllerNumber=1 scan=7199           3    1
#> 2513 controllerType=0 controllerNumber=1 scan=6348           3    1
#> 2514 controllerType=0 controllerNumber=1 scan=1686           2    1
#> 2515 controllerType=0 controllerNumber=1 scan=7311           2    1
#> 2516 controllerType=0 controllerNumber=1 scan=1585           2    1
#> 2517 controllerType=0 controllerNumber=1 scan=1243           4    1
#> 2518 controllerType=0 controllerNumber=1 scan=2684           2    1
#> 2519 controllerType=0 controllerNumber=1 scan=1527           3    1
#> 2520 controllerType=0 controllerNumber=1 scan=1841           2    1
#> 2521 controllerType=0 controllerNumber=1 scan=4806           4    1
#> 2522 controllerType=0 controllerNumber=1 scan=4807           3    1
#> 2523 controllerType=0 controllerNumber=1 scan=7173           2    1
#> 2524 controllerType=0 controllerNumber=1 scan=4461           2    1
#> 2525 controllerType=0 controllerNumber=1 scan=1094           4    1
#> 2526 controllerType=0 controllerNumber=1 scan=6459           4    1
#> 2527 controllerType=0 controllerNumber=1 scan=4434           2    1
#> 2528 controllerType=0 controllerNumber=1 scan=6817           2    1
#> 2529 controllerType=0 controllerNumber=1 scan=2649           2    1
#> 2530 controllerType=0 controllerNumber=1 scan=5016           3    1
#> 2531 controllerType=0 controllerNumber=1 scan=3136           2    1
#> 2532 controllerType=0 controllerNumber=1 scan=1378           2    1
#> 2533 controllerType=0 controllerNumber=1 scan=4860           3    1
#> 2534 controllerType=0 controllerNumber=1 scan=2548           2    1
#> 2535 controllerType=0 controllerNumber=1 scan=4683           3    1
#> 2536 controllerType=0 controllerNumber=1 scan=1735           2    1
#> 2537 controllerType=0 controllerNumber=1 scan=3019           2    1
#> 2538 controllerType=0 controllerNumber=1 scan=5153           3    1
#> 2539 controllerType=0 controllerNumber=1 scan=1463           2    1
#> 2540 controllerType=0 controllerNumber=1 scan=2131           2    1
#> 2541 controllerType=0 controllerNumber=1 scan=5463           3    1
#> 2542 controllerType=0 controllerNumber=1 scan=5463           3    2
#> 2543 controllerType=0 controllerNumber=1 scan=1121           3    1
#> 2544 controllerType=0 controllerNumber=1 scan=6176           2    1
#> 2545 controllerType=0 controllerNumber=1 scan=3387           2    1
#> 2546 controllerType=0 controllerNumber=1 scan=3505           2    1
#> 2547 controllerType=0 controllerNumber=1 scan=3640           3    1
#> 2548 controllerType=0 controllerNumber=1 scan=6184           2    1
#> 2549 controllerType=0 controllerNumber=1 scan=1946           2    1
#> 2550 controllerType=0 controllerNumber=1 scan=2959           2    1
#> 2551 controllerType=0 controllerNumber=1 scan=3285           2    1
#> 2552 controllerType=0 controllerNumber=1 scan=4184           3    1
#> 2553 controllerType=0 controllerNumber=1 scan=4929           2    1
#> 2554 controllerType=0 controllerNumber=1 scan=6807           2    1
#> 2555 controllerType=0 controllerNumber=1 scan=4011           3    1
#> 2556 controllerType=0 controllerNumber=1 scan=6666           2    1
#> 2557 controllerType=0 controllerNumber=1 scan=5747           2    1
#> 2558 controllerType=0 controllerNumber=1 scan=2234           2    1
#> 2559 controllerType=0 controllerNumber=1 scan=6599           3    1
#> 2560 controllerType=0 controllerNumber=1 scan=6599           3    1
#> 2561 controllerType=0 controllerNumber=1 scan=6599           3    1
#> 2562 controllerType=0 controllerNumber=1 scan=6599           3    1
#> 2563 controllerType=0 controllerNumber=1 scan=2225           2    1
#> 2564 controllerType=0 controllerNumber=1 scan=4878           2    1
#> 2565 controllerType=0 controllerNumber=1 scan=1490           3    1
#> 2566 controllerType=0 controllerNumber=1 scan=6553           2    1
#> 2567 controllerType=0 controllerNumber=1 scan=3658           2    2
#> 2568 controllerType=0 controllerNumber=1 scan=3490           2    1
#> 2569 controllerType=0 controllerNumber=1 scan=5081           3    1
#> 2570 controllerType=0 controllerNumber=1 scan=4603           3    1
#> 2571 controllerType=0 controllerNumber=1 scan=6213           2    1
#> 2572 controllerType=0 controllerNumber=1 scan=2458           3    1
#> 2573 controllerType=0 controllerNumber=1 scan=2458           3    2
#> 2574 controllerType=0 controllerNumber=1 scan=1185           3    1
#> 2575 controllerType=0 controllerNumber=1 scan=4665           3    1
#> 2576 controllerType=0 controllerNumber=1 scan=4630           3    1
#> 2577 controllerType=0 controllerNumber=1 scan=5878           6    1
#> 2578 controllerType=0 controllerNumber=1 scan=3427           2    1
#> 2579 controllerType=0 controllerNumber=1 scan=5129           3    1
#> 2580 controllerType=0 controllerNumber=1 scan=4947           2    1
#> 2581 controllerType=0 controllerNumber=1 scan=2240           3    1
#> 2582 controllerType=0 controllerNumber=1 scan=2612           3    1
#> 2583 controllerType=0 controllerNumber=1 scan=6002           2    1
#> 2584 controllerType=0 controllerNumber=1 scan=5763           3    2
#> 2585 controllerType=0 controllerNumber=1 scan=1367           2    1
#> 2586 controllerType=0 controllerNumber=1 scan=2079           3    1
#> 2587 controllerType=0 controllerNumber=1 scan=4390           2    1
#> 2588 controllerType=0 controllerNumber=1 scan=6287           4    1
#> 2589 controllerType=0 controllerNumber=1 scan=4143           2    1
#> 2590 controllerType=0 controllerNumber=1 scan=4749           3    1
#> 2591 controllerType=0 controllerNumber=1 scan=5303           3    1
#> 2592 controllerType=0 controllerNumber=1 scan=6440           2    1
#> 2593 controllerType=0 controllerNumber=1 scan=3637           2    1
#> 2594 controllerType=0 controllerNumber=1 scan=5523           2    1
#> 2595 controllerType=0 controllerNumber=1 scan=1474           2    1
#> 2596 controllerType=0 controllerNumber=1 scan=1474           2    1
#> 2597 controllerType=0 controllerNumber=1 scan=4463           3    1
#> 2598 controllerType=0 controllerNumber=1 scan=3106           2    1
#> 2599 controllerType=0 controllerNumber=1 scan=1356           2    1
#> 2600 controllerType=0 controllerNumber=1 scan=6592           3    1
#> 2601 controllerType=0 controllerNumber=1 scan=2296           2    1
#> 2602 controllerType=0 controllerNumber=1 scan=1420           2    1
#> 2603 controllerType=0 controllerNumber=1 scan=4640           2    2
#> 2604 controllerType=0 controllerNumber=1 scan=6979           2    1
#> 2605 controllerType=0 controllerNumber=1 scan=6979           2    1
#> 2606 controllerType=0 controllerNumber=1 scan=3289           2    1
#> 2607 controllerType=0 controllerNumber=1 scan=2929           3    1
#> 2608 controllerType=0 controllerNumber=1 scan=6022           3    1
#> 2609 controllerType=0 controllerNumber=1 scan=6096           2    1
#> 2610 controllerType=0 controllerNumber=1 scan=6351           2    1
#> 2611 controllerType=0 controllerNumber=1 scan=4858           3    1
#> 2612 controllerType=0 controllerNumber=1 scan=1685           2    1
#> 2613 controllerType=0 controllerNumber=1 scan=5441           3    1
#> 2614 controllerType=0 controllerNumber=1 scan=5022           3    1
#> 2615 controllerType=0 controllerNumber=1 scan=3139           2    1
#> 2616 controllerType=0 controllerNumber=1 scan=1967           2    1
#> 2617 controllerType=0 controllerNumber=1 scan=2415           2    1
#> 2618 controllerType=0 controllerNumber=1 scan=1232           3    1
#> 2619 controllerType=0 controllerNumber=1 scan=1173           2    1
#> 2620 controllerType=0 controllerNumber=1 scan=5281           3    1
#> 2621 controllerType=0 controllerNumber=1 scan=1756           2    1
#> 2622 controllerType=0 controllerNumber=1 scan=6834           2    1
#> 2623 controllerType=0 controllerNumber=1 scan=6834           2    2
#> 2624 controllerType=0 controllerNumber=1 scan=6790           2    1
#> 2625 controllerType=0 controllerNumber=1 scan=1384           2    1
#> 2626 controllerType=0 controllerNumber=1 scan=1067           2    1
#> 2627 controllerType=0 controllerNumber=1 scan=4660           2    1
#> 2628 controllerType=0 controllerNumber=1 scan=4660           2    2
#> 2629 controllerType=0 controllerNumber=1 scan=2833           2    1
#> 2630 controllerType=0 controllerNumber=1 scan=3131           2    1
#> 2631 controllerType=0 controllerNumber=1 scan=3131           2    2
#> 2632 controllerType=0 controllerNumber=1 scan=3559           2    1
#> 2633 controllerType=0 controllerNumber=1 scan=3265           2    1
#> 2634 controllerType=0 controllerNumber=1 scan=5461           3    1
#> 2635 controllerType=0 controllerNumber=1 scan=1063           3    2
#> 2636 controllerType=0 controllerNumber=1 scan=5896           3    1
#> 2637 controllerType=0 controllerNumber=1 scan=4690           2    1
#> 2638 controllerType=0 controllerNumber=1 scan=4525           3    1
#> 2639 controllerType=0 controllerNumber=1 scan=1422           3    1
#> 2640 controllerType=0 controllerNumber=1 scan=1449           3    1
#> 2641 controllerType=0 controllerNumber=1 scan=2669           3    1
#> 2642 controllerType=0 controllerNumber=1 scan=7122           3    1
#> 2643 controllerType=0 controllerNumber=1 scan=1737           2    1
#> 2644 controllerType=0 controllerNumber=1 scan=5835           3    1
#> 2645 controllerType=0 controllerNumber=1 scan=5743           4    1
#> 2646 controllerType=0 controllerNumber=1 scan=5402           3    1
#> 2647 controllerType=0 controllerNumber=1 scan=5849           3    1
#> 2648 controllerType=0 controllerNumber=1 scan=3103           2    1
#> 2649 controllerType=0 controllerNumber=1 scan=1646           2    1
#> 2650 controllerType=0 controllerNumber=1 scan=2465           3    1
#> 2651 controllerType=0 controllerNumber=1 scan=5626           3    1
#> 2652 controllerType=0 controllerNumber=1 scan=6089           2    1
#> 2653 controllerType=0 controllerNumber=1 scan=1363           2    1
#> 2654 controllerType=0 controllerNumber=1 scan=5906           3    1
#> 2655 controllerType=0 controllerNumber=1 scan=4065           3    1
#> 2656 controllerType=0 controllerNumber=1 scan=2951           2    1
#> 2657 controllerType=0 controllerNumber=1 scan=7116           3    1
#> 2658 controllerType=0 controllerNumber=1 scan=4771           2    1
#> 2659 controllerType=0 controllerNumber=1 scan=2775           3    1
#> 2660 controllerType=0 controllerNumber=1 scan=4264           2    1
#> 2661 controllerType=0 controllerNumber=1 scan=1708           2    1
#> 2662 controllerType=0 controllerNumber=1 scan=7263           2    1
#> 2663 controllerType=0 controllerNumber=1 scan=6602           4    1
#> 2664 controllerType=0 controllerNumber=1 scan=3470           3    1
#> 2665 controllerType=0 controllerNumber=1 scan=6453           3    1
#> 2666 controllerType=0 controllerNumber=1 scan=6426           3    1
#> 2667 controllerType=0 controllerNumber=1 scan=2453           4    1
#> 2668 controllerType=0 controllerNumber=1 scan=4899           2    1
#> 2669 controllerType=0 controllerNumber=1 scan=1958           2    1
#> 2670 controllerType=0 controllerNumber=1 scan=5412           2    1
#> 2671 controllerType=0 controllerNumber=1 scan=3795           3    1
#> 2672 controllerType=0 controllerNumber=1 scan=1622           2    1
#> 2673 controllerType=0 controllerNumber=1 scan=3070           2    1
#> 2674 controllerType=0 controllerNumber=1 scan=5991           3    1
#> 2675 controllerType=0 controllerNumber=1 scan=3727           2    1
#> 2676 controllerType=0 controllerNumber=1 scan=1791           3    1
#> 2677 controllerType=0 controllerNumber=1 scan=6482           3    1
#> 2678 controllerType=0 controllerNumber=1 scan=3630           3    1
#> 2679 controllerType=0 controllerNumber=1 scan=2579           2    1
#> 2680 controllerType=0 controllerNumber=1 scan=6019           3    1
#> 2681 controllerType=0 controllerNumber=1 scan=5563           4    1
#> 2682 controllerType=0 controllerNumber=1 scan=4983           2    1
#> 2683 controllerType=0 controllerNumber=1 scan=2556           2    1
#> 2684 controllerType=0 controllerNumber=1 scan=2365           2    1
#> 2685 controllerType=0 controllerNumber=1 scan=3309           3    1
#> 2686 controllerType=0 controllerNumber=1 scan=1116           3    1
#> 2687 controllerType=0 controllerNumber=1 scan=1278           2    1
#> 2688 controllerType=0 controllerNumber=1 scan=5400           3    1
#> 2689 controllerType=0 controllerNumber=1 scan=4500           3    1
#> 2690 controllerType=0 controllerNumber=1 scan=4604           2    1
#> 2691 controllerType=0 controllerNumber=1 scan=6046           3    1
#> 2692 controllerType=0 controllerNumber=1 scan=2942           2    1
#> 2693 controllerType=0 controllerNumber=1 scan=2834           2    1
#> 2694 controllerType=0 controllerNumber=1 scan=4272           3    1
#> 2695 controllerType=0 controllerNumber=1 scan=3138           2    1
#> 2696 controllerType=0 controllerNumber=1 scan=3661           2    1
#> 2697 controllerType=0 controllerNumber=1 scan=4459           3    1
#> 2698 controllerType=0 controllerNumber=1 scan=3182           3    1
#> 2699 controllerType=0 controllerNumber=1 scan=3300           3    1
#> 2700 controllerType=0 controllerNumber=1 scan=1369           3    1
#> 2701 controllerType=0 controllerNumber=1 scan=3025           2    1
#> 2702 controllerType=0 controllerNumber=1 scan=5151           3    1
#> 2703 controllerType=0 controllerNumber=1 scan=2181           2    1
#> 2704 controllerType=0 controllerNumber=1 scan=6716           2    1
#> 2705 controllerType=0 controllerNumber=1 scan=3305           3    1
#> 2706 controllerType=0 controllerNumber=1 scan=5479           2    1
#> 2707 controllerType=0 controllerNumber=1 scan=3767           2    1
#> 2708 controllerType=0 controllerNumber=1 scan=6317           2    1
#> 2709 controllerType=0 controllerNumber=1 scan=5411           2    1
#> 2710 controllerType=0 controllerNumber=1 scan=6323           3    1
#> 2711 controllerType=0 controllerNumber=1 scan=5648           3    1
#> 2712 controllerType=0 controllerNumber=1 scan=4203           2    1
#> 2713 controllerType=0 controllerNumber=1 scan=1174           2    1
#> 2714 controllerType=0 controllerNumber=1 scan=6318           4    1
#> 2715 controllerType=0 controllerNumber=1 scan=5113           4    1
#> 2716 controllerType=0 controllerNumber=1 scan=2002           2    1
#> 2717 controllerType=0 controllerNumber=1 scan=3886           3    1
#> 2718 controllerType=0 controllerNumber=1 scan=5156           3    1
#> 2719 controllerType=0 controllerNumber=1 scan=3153           2    2
#> 2720 controllerType=0 controllerNumber=1 scan=5864           3    1
#> 2721 controllerType=0 controllerNumber=1 scan=7038           2    1
#> 2722 controllerType=0 controllerNumber=1 scan=6442           2    1
#> 2723 controllerType=0 controllerNumber=1 scan=3074           3    1
#> 2724 controllerType=0 controllerNumber=1 scan=5181           2    1
#> 2725 controllerType=0 controllerNumber=1 scan=1433           2    1
#> 2726 controllerType=0 controllerNumber=1 scan=4617           2    1
#> 2727 controllerType=0 controllerNumber=1 scan=2988           2    1
#> 2728 controllerType=0 controllerNumber=1 scan=3085           2    1
#> 2729 controllerType=0 controllerNumber=1 scan=4585           3    1
#> 2730 controllerType=0 controllerNumber=1 scan=5951           3    1
#> 2731 controllerType=0 controllerNumber=1 scan=6395           2    1
#> 2732 controllerType=0 controllerNumber=1 scan=7442           2    1
#> 2733 controllerType=0 controllerNumber=1 scan=4020           3    1
#> 2734 controllerType=0 controllerNumber=1 scan=6285           3    1
#> 2735 controllerType=0 controllerNumber=1 scan=5278           3    1
#> 2736 controllerType=0 controllerNumber=1 scan=6052           3    1
#> 2737 controllerType=0 controllerNumber=1 scan=2693           2    1
#> 2738 controllerType=0 controllerNumber=1 scan=2693           2    1
#> 2739 controllerType=0 controllerNumber=1 scan=4584           2    1
#> 2740 controllerType=0 controllerNumber=1 scan=2441           2    1
#> 2741 controllerType=0 controllerNumber=1 scan=5285           3    1
#> 2742 controllerType=0 controllerNumber=1 scan=6583           2    1
#> 2743 controllerType=0 controllerNumber=1 scan=3230           2    1
#> 2744 controllerType=0 controllerNumber=1 scan=4018           3    1
#> 2745 controllerType=0 controllerNumber=1 scan=5542           3    1
#> 2746 controllerType=0 controllerNumber=1 scan=4009           2    1
#> 2747 controllerType=0 controllerNumber=1 scan=3736           2    1
#> 2748 controllerType=0 controllerNumber=1 scan=3798           2    1
#> 2749 controllerType=0 controllerNumber=1 scan=4863           3    1
#> 2750 controllerType=0 controllerNumber=1 scan=6761           2    1
#> 2751 controllerType=0 controllerNumber=1 scan=7244           3    1
#> 2752 controllerType=0 controllerNumber=1 scan=1388           2    1
#> 2753 controllerType=0 controllerNumber=1 scan=7287           2    1
#> 2754 controllerType=0 controllerNumber=1 scan=2765           3    1
#> 2755 controllerType=0 controllerNumber=1 scan=4024           3    1
#> 2756 controllerType=0 controllerNumber=1 scan=4441           3    1
#> 2757 controllerType=0 controllerNumber=1 scan=5611           2    1
#> 2758 controllerType=0 controllerNumber=1 scan=3231           2    1
#> 2759 controllerType=0 controllerNumber=1 scan=4185           2    1
#> 2760 controllerType=0 controllerNumber=1 scan=4613           3    1
#> 2761 controllerType=0 controllerNumber=1 scan=4282           3    1
#> 2762 controllerType=0 controllerNumber=1 scan=7353           2    1
#> 2763 controllerType=0 controllerNumber=1 scan=6607           2    1
#> 2764 controllerType=0 controllerNumber=1 scan=1567           2    1
#> 2765 controllerType=0 controllerNumber=1 scan=6115           2    1
#> 2766 controllerType=0 controllerNumber=1 scan=3859           3    1
#> 2767 controllerType=0 controllerNumber=1 scan=3859           3    2
#> 2768 controllerType=0 controllerNumber=1 scan=1722           2    1
#> 2769 controllerType=0 controllerNumber=1 scan=1594           3    1
#> 2770 controllerType=0 controllerNumber=1 scan=4682           3    1
#> 2771 controllerType=0 controllerNumber=1 scan=2809           2    1
#> 2772 controllerType=0 controllerNumber=1 scan=3532           3    1
#> 2773 controllerType=0 controllerNumber=1 scan=5429           3    1
#> 2774 controllerType=0 controllerNumber=1 scan=7386           2    1
#> 2775 controllerType=0 controllerNumber=1 scan=3900           3    1
#> 2776 controllerType=0 controllerNumber=1 scan=6240           2    1
#> 2777 controllerType=0 controllerNumber=1 scan=2223           2    1
#> 2778 controllerType=0 controllerNumber=1 scan=4351           2    1
#> 2779 controllerType=0 controllerNumber=1 scan=3122           3    1
#> 2780 controllerType=0 controllerNumber=1 scan=2325           2    1
#> 2781 controllerType=0 controllerNumber=1 scan=2341           3    1
#> 2782 controllerType=0 controllerNumber=1 scan=4262           2    1
#> 2783 controllerType=0 controllerNumber=1 scan=1314           2    1
#> 2784 controllerType=0 controllerNumber=1 scan=1444           2    1
#> 2785 controllerType=0 controllerNumber=1 scan=6049           2    1
#> 2786 controllerType=0 controllerNumber=1 scan=3158           2    1
#> 2787 controllerType=0 controllerNumber=1 scan=2024           2    1
#> 2788 controllerType=0 controllerNumber=1 scan=3536           3    1
#> 2789 controllerType=0 controllerNumber=1 scan=3377           2    1
#> 2790 controllerType=0 controllerNumber=1 scan=4356           3    1
#> 2791 controllerType=0 controllerNumber=1 scan=4627           2    1
#> 2792 controllerType=0 controllerNumber=1 scan=2781           2    1
#> 2793 controllerType=0 controllerNumber=1 scan=2781           2    2
#> 2794 controllerType=0 controllerNumber=1 scan=3293           3    1
#> 2795 controllerType=0 controllerNumber=1 scan=1748           2    1
#> 2796 controllerType=0 controllerNumber=1 scan=1459           2    1
#> 2797 controllerType=0 controllerNumber=1 scan=4236           3    1
#> 2798 controllerType=0 controllerNumber=1 scan=1710           3    1
#> 2799 controllerType=0 controllerNumber=1 scan=3026           2    1
#> 2800 controllerType=0 controllerNumber=1 scan=6498           2    1
#> 2801 controllerType=0 controllerNumber=1 scan=5693           2    1
#> 2802 controllerType=0 controllerNumber=1 scan=7154           2    1
#> 2803 controllerType=0 controllerNumber=1 scan=2827           2    1
#> 2804 controllerType=0 controllerNumber=1 scan=6048           3    1
#> 2805 controllerType=0 controllerNumber=1 scan=4472           3    1
#> 2806 controllerType=0 controllerNumber=1 scan=4731           3    1
#> 2807 controllerType=0 controllerNumber=1 scan=4241           2    1
#> 2808 controllerType=0 controllerNumber=1 scan=4241           2    2
#> 2809 controllerType=0 controllerNumber=1 scan=2244           2    1
#> 2810 controllerType=0 controllerNumber=1 scan=5124           2    1
#> 2811 controllerType=0 controllerNumber=1 scan=3604           3    1
#> 2812 controllerType=0 controllerNumber=1 scan=4158           3    1
#> 2813 controllerType=0 controllerNumber=1 scan=5588           3    1
#> 2814 controllerType=0 controllerNumber=1 scan=3228           3    1
#> 2815 controllerType=0 controllerNumber=1 scan=7214           2    1
#> 2816 controllerType=0 controllerNumber=1 scan=2757           2    1
#> 2817 controllerType=0 controllerNumber=1 scan=1365           2    1
#> 2818 controllerType=0 controllerNumber=1 scan=3048           2    1
#> 2819 controllerType=0 controllerNumber=1 scan=5831           3    1
#> 2820 controllerType=0 controllerNumber=1 scan=6443           2    1
#> 2821 controllerType=0 controllerNumber=1 scan=3047           2    1
#> 2822 controllerType=0 controllerNumber=1 scan=1403           2    1
#> 2823 controllerType=0 controllerNumber=1 scan=3528           2    1
#> 2824 controllerType=0 controllerNumber=1 scan=5615           2    1
#> 2825 controllerType=0 controllerNumber=1 scan=4383           3    1
#> 2826 controllerType=0 controllerNumber=1 scan=3328           2    1
#> 2827 controllerType=0 controllerNumber=1 scan=1475           2    1
#> 2828 controllerType=0 controllerNumber=1 scan=3829           2    1
#> 2829 controllerType=0 controllerNumber=1 scan=5272           3    1
#> 2830 controllerType=0 controllerNumber=1 scan=3042           2    1
#> 2831 controllerType=0 controllerNumber=1 scan=6023           3    1
#> 2832 controllerType=0 controllerNumber=1 scan=3453           2    1
#> 2833 controllerType=0 controllerNumber=1 scan=2219           2    1
#> 2834 controllerType=0 controllerNumber=1 scan=5171           2    1
#> 2835 controllerType=0 controllerNumber=1 scan=5014           2    1
#> 2836 controllerType=0 controllerNumber=1 scan=6267           3    1
#> 2837 controllerType=0 controllerNumber=1 scan=6529           3    1
#> 2838 controllerType=0 controllerNumber=1 scan=3463           2    1
#> 2839 controllerType=0 controllerNumber=1 scan=3408           3    1
#> 2840 controllerType=0 controllerNumber=1 scan=2541           2    1
#> 2841 controllerType=0 controllerNumber=1 scan=2438           2    1
#> 2842 controllerType=0 controllerNumber=1 scan=4879           2    1
#> 2843 controllerType=0 controllerNumber=1 scan=5065           4    1
#> 2844 controllerType=0 controllerNumber=1 scan=5310           3    1
#> 2845 controllerType=0 controllerNumber=1 scan=6406           2    1
#> 2846 controllerType=0 controllerNumber=1 scan=1498           2    1
#> 2847 controllerType=0 controllerNumber=1 scan=2261           3    1
#> 2848 controllerType=0 controllerNumber=1 scan=4969           2    1
#> 2849 controllerType=0 controllerNumber=1 scan=4064           3    1
#> 2850 controllerType=0 controllerNumber=1 scan=4209           3    1
#> 2851 controllerType=0 controllerNumber=1 scan=2839           2    1
#> 2852  controllerType=0 controllerNumber=1 scan=921           3    2
#> 2853 controllerType=0 controllerNumber=1 scan=5044           3    1
#> 2854 controllerType=0 controllerNumber=1 scan=5618           3    1
#> 2855 controllerType=0 controllerNumber=1 scan=1376           3    1
#> 2856 controllerType=0 controllerNumber=1 scan=1376           3    2
#> 2857 controllerType=0 controllerNumber=1 scan=1504           2    1
#>      passThreshold experimentalMassToCharge calculatedMassToCharge peptideRef
#> 1             TRUE                 548.2856               547.9474      Pep77
#> 2             TRUE                1288.1528              1288.1741     Pep108
#> 3             TRUE                 744.4109               744.4255     Pep136
#> 4             TRUE                 913.1642               912.8134     Pep163
#> 5             TRUE                 926.8102               926.4713     Pep169
#> 6             TRUE                 969.1943               968.8557     Pep206
#> 7             TRUE                1369.2380              1368.7166     Pep163
#> 8             TRUE                1285.3201              1285.0026     Pep216
#> 9             TRUE                1285.3201              1285.0026     Pep216
#> 10            TRUE                1102.0557              1102.0737     Pep223
#> 11            TRUE                 689.3641               689.3510     Pep239
#> 12            TRUE                 553.0107               552.6678     Pep262
#> 13            TRUE                 594.3362               594.3431     Pep267
#> 14            TRUE                 670.3866               670.3796     Pep281
#> 15            TRUE                 793.9449               793.9348     Pep296
#> 16            TRUE                 712.7021               712.3761     Pep319
#> 17            TRUE                 870.0042               869.9917     Pep321
#> 18            TRUE                 629.3327               629.0035     Pep339
#> 19            TRUE                 531.3071               530.8002     Pep357
#> 20            TRUE                 811.7632               811.4417     Pep393
#> 21            TRUE                 803.6677               803.6685     Pep394
#> 22            TRUE                 919.8344               919.4899     Pep407
#> 23            TRUE                 698.6633               698.3315     Pep453
#> 24            TRUE                 698.6633               698.3315     Pep453
#> 25            TRUE                 698.6633               698.3315     Pep453
#> 26            TRUE                 698.6633               698.3315     Pep453
#> 27            TRUE                 792.7727               792.7578     Pep456
#> 28            TRUE                 646.3819               646.3744     Pep465
#> 29            TRUE                 488.2881               487.7818     Pep472
#> 30            TRUE                 936.4349               936.4317     Pep495
#> 31            TRUE                 936.4349               936.4317     Pep495
#> 32            TRUE                 811.9041               811.4038     Pep535
#> 33            TRUE                 523.7744               523.2766     Pep543
#> 34            TRUE                 812.7909               812.7817     Pep551
#> 35            TRUE                 893.4711               893.4589     Pep562
#> 36            TRUE                 725.0412               725.0358     Pep576
#> 37            TRUE                 866.9489               866.6992     Pep577
#> 38            TRUE                 884.7771               884.4455     Pep581
#> 39            TRUE                 925.4853               924.9911     Pep595
#> 40            TRUE                1266.9756              1266.9735     Pep615
#> 41            TRUE                 571.3221               571.3118     Pep639
#> 42            TRUE                 571.3221               571.3118     Pep639
#> 43            TRUE                 532.8016               532.8053     Pep641
#> 44            TRUE                 609.8445               609.6033     Pep642
#> 45            TRUE                 609.8445               609.6033     Pep642
#> 46            TRUE                 660.3183               660.3190     Pep647
#> 47            TRUE                 552.3325               552.3339     Pep650
#> 48            TRUE                 601.3526               601.3510     Pep671
#> 49            TRUE                1132.3175              1132.3336     Pep677
#> 50            TRUE                 846.1097               845.7761     Pep682
#> 51            TRUE                 502.7639               502.7689     Pep689
#> 52            TRUE                 702.0578               701.7184     Pep694
#> 53            TRUE                 691.3763               690.8619     Pep695
#> 54            TRUE                 660.3170               660.3190     Pep647
#> 55            TRUE                1178.9232              1178.9119     Pep705
#> 56            TRUE                1037.8489              1037.5004     Pep709
#> 57            TRUE                 607.6503               607.6457     Pep716
#> 58            TRUE                 706.6838               706.3600     Pep719
#> 59            TRUE                1134.0720              1134.0894     Pep720
#> 60            TRUE                 647.8737               647.8822     Pep723
#> 61            TRUE                 880.9629               880.9543     Pep739
#> 62            TRUE                 961.1826               961.1879     Pep740
#> 63            TRUE                 624.3314               624.3425     Pep754
#> 64            TRUE                 783.7580               783.7701     Pep759
#> 65            TRUE                 484.2332               484.2426     Pep775
#> 66            TRUE                 582.0079               581.6702     Pep786
#> 67            TRUE                 998.1753               998.1702     Pep789
#> 68            TRUE                 811.7523               811.7472     Pep790
#> 69            TRUE                1051.0818              1051.0627     Pep795
#> 70            TRUE                1139.9170              1139.9318     Pep796
#> 71            TRUE                 919.4728               918.9673     Pep803
#> 72            TRUE                 848.4443               848.4598     Pep809
#> 73            TRUE                 923.0027               922.7520     Pep814
#> 74            TRUE                 904.4612               904.2250     Pep815
#> 75            TRUE                 718.3931               718.3842     Pep823
#> 76            TRUE                 728.4247               728.4124     Pep828
#> 77            TRUE                 728.4247               728.4124     Pep828
#> 78            TRUE                 757.4008               757.3952     Pep831
#> 79            TRUE                1356.7290              1356.2129     Pep832
#> 80            TRUE                 606.8036               606.7952     Pep836
#> 81            TRUE                 665.3824               665.3872     Pep837
#> 82            TRUE                 578.9797               578.9703     Pep856
#> 83            TRUE                 578.9797               578.9703     Pep856
#> 84            TRUE                 431.2310               430.8947     Pep861
#> 85            TRUE                 573.8486               573.3378     Pep871
#> 86            TRUE                 701.0565               701.0442     Pep795
#> 87            TRUE                1071.2216              1070.8718     Pep893
#> 88            TRUE                1071.2216              1070.8718     Pep893
#> 89            TRUE                 425.0411               424.8404     Pep894
#> 90            TRUE                 425.0411               424.8404     Pep894
#> 91            TRUE                 659.3900               659.0569     Pep908
#> 92            TRUE                 850.1168               850.1149     Pep916
#> 93            TRUE                1293.6417              1293.1425     Pep917
#> 94            TRUE                 965.8336               965.5124     Pep919
#> 95            TRUE                 495.7739               495.2760     Pep925
#> 96            TRUE                 951.2226               950.9867     Pep933
#> 97            TRUE                 767.7464               767.4232     Pep936
#> 98            TRUE                 904.7014               904.4681     Pep944
#> 99            TRUE                 772.6910               772.6813     Pep965
#> 100           TRUE                 555.2985               555.2922     Pep997
#> 101           TRUE                 724.0462               724.0503    Pep1000
#> 102           TRUE                 512.2877               511.9450    Pep1005
#> 103           TRUE                 885.9774               885.7253    Pep1007
#> 104           TRUE                 632.3503               632.0074    Pep1022
#> 105           TRUE                 820.0381               819.7192    Pep1027
#> 106           TRUE                 812.4537               812.4687     Pep642
#> 107           TRUE                 812.4537               812.4687     Pep642
#> 108           TRUE                 645.3513               644.8488    Pep1049
#> 109           TRUE                 908.8092               908.7953    Pep1061
#> 110           TRUE                 923.8304               923.4782    Pep1068
#> 111           TRUE                 602.6357               602.6348    Pep1094
#> 112           TRUE                 602.6357               602.6348    Pep1094
#> 113           TRUE                1143.8556              1143.5894    Pep1104
#> 114           TRUE                 693.7589               693.7674    Pep1112
#> 115           TRUE                1014.5425              1014.5503    Pep1114
#> 116           TRUE                1004.0566              1003.5430    Pep1116
#> 117           TRUE                1026.5413              1026.5477    Pep1129
#> 118           TRUE                1217.1414              1216.6589     Pep393
#> 119           TRUE                 901.0240               900.5137    Pep1155
#> 120           TRUE                1052.8374              1052.5070    Pep1187
#> 121           TRUE                 903.4492               902.9591    Pep1189
#> 122           TRUE                 873.4592               873.4621    Pep1192
#> 123           TRUE                1058.2551              1058.2440     Pep296
#> 124           TRUE                 668.3640               668.3581    Pep1208
#> 125           TRUE                 647.6578               647.3291    Pep1210
#> 126           TRUE                 813.7535               813.7602    Pep1214
#> 127           TRUE                 645.8073               645.8090    Pep1250
#> 128           TRUE                 789.4403               788.9463    Pep1258
#> 129           TRUE                 677.3848               677.1221    Pep1261
#> 130           TRUE                1046.5304              1046.2118    Pep1272
#> 131           TRUE                 875.4539               875.4636    Pep1294
#> 132           TRUE                1021.2147              1020.8656    Pep1306
#> 133           TRUE                 838.1765               837.9329    Pep1312
#> 134           TRUE                 883.0026               882.9882    Pep1329
#> 135           TRUE                 778.4530               778.1035    Pep1343
#> 136           TRUE                 502.2707               501.9284    Pep1346
#> 137           TRUE                 502.2707               501.9284    Pep1346
#> 138           TRUE                 896.4697               895.9722    Pep1358
#> 139           TRUE                1080.2681              1080.2467    Pep1365
#> 140           TRUE                 933.8182               933.4816    Pep1369
#> 141           TRUE                 933.8182               933.4816    Pep1369
#> 142           TRUE                 908.5092               908.4965    Pep1379
#> 143           TRUE                 883.8190               883.4731    Pep1388
#> 144           TRUE                 860.8179               860.8053    Pep1399
#> 145           TRUE                 860.8179               860.8053    Pep1399
#> 146           TRUE                1053.0555              1052.7904    Pep1406
#> 147           TRUE                 811.1142               811.1077    Pep1410
#> 148           TRUE                1012.8682              1012.8574    Pep1457
#> 149           TRUE                1010.8693              1010.8644    Pep1463
#> 150           TRUE                 925.8152               925.4911    Pep1472
#> 151           TRUE                 998.9929               998.7441    Pep1492
#> 152           TRUE                 998.9929               998.7441    Pep1492
#> 153           TRUE                1065.0397              1064.8064    Pep1502
#> 154           TRUE                 785.3867               785.3975    Pep1512
#> 155           TRUE                 603.8390               603.3372    Pep1525
#> 156           TRUE                 840.4456               840.4481    Pep1542
#> 157           TRUE                 783.0700               782.7460    Pep1544
#> 158           TRUE                1037.5140              1037.5071    Pep1555
#> 159           TRUE                1216.1683              1216.1580    Pep1410
#> 160           TRUE                 430.5536               430.5570    Pep1566
#> 161           TRUE                 443.4605               443.4636    Pep1569
#> 162           TRUE                 845.7736               845.7807    Pep1576
#> 163           TRUE                 825.1177               825.1099    Pep1579
#> 164           TRUE                 495.2949               494.7896    Pep1580
#> 165           TRUE                 562.6534               562.6592    Pep1593
#> 166           TRUE                1388.2202              1388.1985    Pep1621
#> 167           TRUE                1053.3000              1053.0350    Pep1625
#> 168           TRUE                 496.7456               496.7451    Pep1640
#> 169           TRUE                 633.0522               633.0520    Pep1661
#> 170           TRUE                 555.9612               555.9507    Pep1664
#> 171           TRUE                1108.9296              1108.9175    Pep1681
#> 172           TRUE                1108.9296              1108.9175    Pep1681
#> 173           TRUE                 825.1187               825.1099    Pep1579
#> 174           TRUE                 808.4325               808.1030    Pep1700
#> 175           TRUE                 661.6865               661.3560    Pep1712
#> 176           TRUE                 878.9427               878.6976    Pep1718
#> 177           TRUE                 878.9427               878.6976    Pep1718
#> 178           TRUE                 613.6508               613.6398    Pep1751
#> 179           TRUE                 681.7452               681.4054    Pep1786
#> 180           TRUE                 594.8549               594.3431     Pep267
#> 181           TRUE                 980.4916               980.5107    Pep1819
#> 182           TRUE                 617.7044               617.3767    Pep1827
#> 183           TRUE                 712.8807               712.3886    Pep1838
#> 184           TRUE                 821.0538               820.7194    Pep1842
#> 185           TRUE                 763.3945               763.4057    Pep1845
#> 186           TRUE                 466.2778               465.7743    Pep1859
#> 187           TRUE                 519.6440               519.6362    Pep1879
#> 188           TRUE                1022.1166              1021.6044    Pep1786
#> 189           TRUE                 803.6677               803.4236    Pep1882
#> 190           TRUE                 555.7979               555.2922     Pep997
#> 191           TRUE                 767.9267               767.9241    Pep1898
#> 192           TRUE                 969.1287               968.8034    Pep1919
#> 193           TRUE                 593.3428               593.3333    Pep1943
#> 194           TRUE                 779.0983               778.7595    Pep1959
#> 195           TRUE                 749.9070               749.4139    Pep1971
#> 196           TRUE                 619.0097               619.0013    Pep1991
#> 197           TRUE                 690.7069               690.7081    Pep1995
#> 198           TRUE                1116.6003              1116.2555    Pep1996
#> 199           TRUE                 698.0696               697.7221    Pep1999
#> 200           TRUE                1061.6035              1061.1017    Pep2001
#> 201           TRUE                1061.8882              1061.8816    Pep2021
#> 202           TRUE                1061.8882              1061.8816    Pep2021
#> 203           TRUE                1011.0991              1011.0825    Pep2024
#> 204           TRUE                 919.1851               918.8383    Pep2030
#> 205           TRUE                 906.1797               906.1722    Pep2042
#> 206           TRUE                 978.0320               977.7911    Pep2063
#> 207           TRUE                1139.2848              1139.2708    Pep2074
#> 208           TRUE                 974.4650               974.1359    Pep2092
#> 209           TRUE                1130.9253              1130.9097    Pep2101
#> 210           TRUE                 821.9791               821.9929    Pep2107
#> 211           TRUE                 697.0654               696.7213    Pep2128
#> 212           TRUE                 637.3836               637.3797    Pep2139
#> 213           TRUE                 605.3282               604.8321    Pep2169
#> 214           TRUE                 875.9757               875.9601    Pep2177
#> 215           TRUE                 951.2292               951.2147    Pep2185
#> 216           TRUE                 951.2292               951.2147    Pep2185
#> 217           TRUE                 624.3685               624.3613    Pep2195
#> 218           TRUE                 836.8116               836.4795    Pep2198
#> 219           TRUE                1110.1315              1110.1300    Pep2199
#> 220           TRUE                 825.3698               825.0499    Pep2201
#> 221           TRUE                 723.9216               723.4095    Pep2204
#> 222           TRUE                1102.6133              1102.6122    Pep2213
#> 223           TRUE                1097.0930              1097.0917    Pep2249
#> 224           TRUE                 819.9064               819.3940    Pep2255
#> 225           TRUE                 819.9064               819.9065    Pep2256
#> 226           TRUE                1042.5695              1042.5499    Pep2266
#> 227           TRUE                 692.0107               691.6694    Pep2272
#> 228           TRUE                 692.0107               691.6694    Pep2272
#> 229           TRUE                 967.5033               967.5188    Pep2274
#> 230           TRUE                1205.0839              1205.1027    Pep2298
#> 231           TRUE                 780.1171               779.7789    Pep2316
#> 232           TRUE                 910.1791               909.8340    Pep2321
#> 233           TRUE                 766.7142               766.7183    Pep2328
#> 234           TRUE                 824.4647               824.4603    Pep2343
#> 235           TRUE                 590.9442               590.9491    Pep1569
#> 236           TRUE                1248.0116              1248.0222    Pep2355
#> 237           TRUE                 806.8035               806.4555    Pep2360
#> 238           TRUE                1389.7490              1389.2357    Pep2362
#> 239           TRUE                1045.2267              1045.2140    Pep2364
#> 240           TRUE                 774.9510               774.6854    Pep2365
#> 241           TRUE                 793.9263               793.4388    Pep2373
#> 242           TRUE                 585.0002               584.6544    Pep2380
#> 243           TRUE                 916.2230               916.2253    Pep2418
#> 244           TRUE                 595.3673               595.3574    Pep2427
#> 245           TRUE                 850.9336               850.9269    Pep2432
#> 246           TRUE                 577.6727               577.3309    Pep2434
#> 247           TRUE                 767.6451               767.4077    Pep2456
#> 248           TRUE                 767.6451               767.4077    Pep2456
#> 249           TRUE                 741.7375               741.4052    Pep2458
#> 250           TRUE                1462.4502              1462.4531    Pep2249
#> 251           TRUE                 756.4045               756.0598    Pep2471
#> 252           TRUE                1247.3016              1246.9594    Pep2484
#> 253           TRUE                1247.3016              1246.9594    Pep2484
#> 254           TRUE                1221.2924              1221.3077    Pep2498
#> 255           TRUE                 531.7607               531.2671    Pep2511
#> 256           TRUE                 538.7975               538.2931    Pep2517
#> 257           TRUE                 948.5413               948.2085    Pep2523
#> 258           TRUE                1017.0568              1016.5415    Pep2539
#> 259           TRUE                 740.9142               740.6538    Pep2553
#> 260           TRUE                1064.2069              1063.8909    Pep2564
#> 261           TRUE                 967.5156               967.1993    Pep2571
#> 262           TRUE                 982.1420               982.1508    Pep2578
#> 263           TRUE                 982.1420               982.1508    Pep2578
#> 264           TRUE                 770.4041               770.4012    Pep2603
#> 265           TRUE                 568.9926               568.6581    Pep2609
#> 266           TRUE                 673.3287               673.0000    Pep2634
#> 267           TRUE                 673.3287               673.0000    Pep2634
#> 268           TRUE                 457.6121               457.2785    Pep2657
#> 269           TRUE                 630.0383               629.6964    Pep2668
#> 270           TRUE                 904.9065               904.4147    Pep2673
#> 271           TRUE                1005.5699              1005.0735    Pep2676
#> 272           TRUE                1069.5756              1069.5618    Pep2678
#> 273           TRUE                 742.7161               742.3721    Pep2682
#> 274           TRUE                 907.4969               907.0113    Pep2687
#> 275           TRUE                 593.6609               593.3333    Pep2705
#> 276           TRUE                 509.9913               509.6486    Pep2707
#> 277           TRUE                1028.4463              1027.9603    Pep2711
#> 278           TRUE                1028.4463              1027.9603    Pep2711
#> 279           TRUE                1028.4463              1027.9603    Pep2711
#> 280           TRUE                 859.7805               859.7828    Pep2726
#> 281           TRUE                 964.2415               963.9766    Pep2764
#> 282           TRUE                 940.1981               939.8468    Pep2765
#> 283           TRUE                 940.1981               939.8562    Pep2766
#> 284           TRUE                 721.4152               721.4086    Pep2767
#> 285           TRUE                 999.0539               998.5610    Pep2781
#> 286           TRUE                 807.4242               807.4203    Pep2787
#> 287           TRUE                 573.2679               573.2764    Pep2794
#> 288           TRUE                 832.7947               832.4468    Pep2799
#> 289           TRUE                 951.0246               951.0266    Pep2804
#> 290           TRUE                 790.4173               790.4191    Pep2850
#> 291           TRUE                 713.4431               713.4341    Pep2864
#> 292           TRUE                 438.2430               438.2350    Pep2880
#> 293           TRUE                 544.6201               544.6288    Pep2883
#> 294           TRUE                 582.3293               582.3214    Pep2902
#> 295           TRUE                 565.2679               564.7700    Pep2903
#> 296           TRUE                 517.3036               517.3004    Pep2910
#> 297           TRUE                 922.0498               922.0384    Pep2912
#> 298           TRUE                 510.7885               510.7796    Pep2940
#> 299           TRUE                1085.4792              1085.4991    Pep2950
#> 300           TRUE                 877.4624               877.1412    Pep2991
#> 301           TRUE                1020.2392              1019.8849    Pep2995
#> 302           TRUE                1020.2392              1020.2301    Pep2996
#> 303           TRUE                 899.4926               899.4885    Pep3000
#> 304           TRUE                 886.4908               886.4960    Pep3002
#> 305           TRUE                 668.3461               668.3581    Pep1208
#> 306           TRUE                 658.0690               657.7263    Pep3025
#> 307           TRUE                 526.6302               526.2999    Pep1258
#> 308           TRUE                 841.9927               841.9815    Pep3049
#> 309           TRUE                 699.3752               699.3716    Pep3075
#> 310           TRUE                 889.8051               889.4843    Pep3076
#> 311           TRUE                 889.8051               889.4843    Pep3076
#> 312           TRUE                 882.1280               882.1160    Pep3108
#> 313           TRUE                 532.2488               532.2572    Pep3115
#> 314           TRUE                 823.4467               823.4445    Pep3123
#> 315           TRUE                1115.5759              1115.2450    Pep3129
#> 316           TRUE                 622.6910               622.6930    Pep3140
#> 317           TRUE                 862.7618               862.4307     Pep917
#> 318           TRUE                 602.6882               602.6833    Pep3150
#> 319           TRUE                 635.6905               635.3593    Pep3177
#> 320           TRUE                 795.8755               795.6252    Pep3197
#> 321           TRUE                 655.8412               655.3321    Pep3226
#> 322           TRUE                1060.8342              1060.4916    Pep3232
#> 323           TRUE                 678.7028               678.7155    Pep3241
#> 324           TRUE                 912.1470               911.8003    Pep3247
#> 325           TRUE                 708.0461               708.0369    Pep3254
#> 326           TRUE                 462.2457               462.2420    Pep3260
#> 327           TRUE                 863.8102               863.4636    Pep3264
#> 328           TRUE                 859.3981               859.4110    Pep2794
#> 329           TRUE                 719.4072               719.0661    Pep3280
#> 330           TRUE                 885.0692               884.8694    Pep3291
#> 331           TRUE                 694.0057               693.6752    Pep3314
#> 332           TRUE                 694.0057               693.6752    Pep3314
#> 333           TRUE                 563.2701               562.7795    Pep3330
#> 334           TRUE                1076.5437              1076.3142    Pep3357
#> 335           TRUE                1001.0613              1000.5777    Pep3359
#> 336           TRUE                1001.0613              1000.5777    Pep3359
#> 337           TRUE                 713.6397               713.3944    Pep3364
#> 338           TRUE                 680.9022               680.3981    Pep3395
#> 339           TRUE                 597.2824               596.7817    Pep3420
#> 340           TRUE                 597.2824               596.7817    Pep3420
#> 341           TRUE                 730.6679               730.6561    Pep3433
#> 342           TRUE                 570.3256               570.3157    Pep3435
#> 343           TRUE                 789.7393               789.4001    Pep3439
#> 344           TRUE                 990.5367               990.5332    Pep3440
#> 345           TRUE                 816.4686               816.4532    Pep3450
#> 346           TRUE                 791.4521               791.4542    Pep3500
#> 347           TRUE                 716.9212               716.4087    Pep3506
#> 348           TRUE                 824.7383               824.7329    Pep3509
#> 349           TRUE                 824.7383               824.7329    Pep3509
#> 350           TRUE                1290.0280              1290.0106    Pep3521
#> 351           TRUE                 777.8950               777.3963    Pep3541
#> 352           TRUE                 947.9089               947.9205    Pep3561
#> 353           TRUE                 673.4148               672.9164    Pep3578
#> 354           TRUE                 729.0873               729.0793    Pep3579
#> 355           TRUE                 988.5815               988.0817     Pep908
#> 356           TRUE                 740.4223               740.4103    Pep3594
#> 357           TRUE                 664.0335               663.6935    Pep3604
#> 358           TRUE                 787.6922               787.4387    Pep3614
#> 359           TRUE                 700.7422               700.4092    Pep3625
#> 360           TRUE                 737.1355               736.8716    Pep3630
#> 361           TRUE                 560.6617               560.3311    Pep3632
#> 362           TRUE                1080.2823              1079.9360    Pep3659
#> 363           TRUE                 801.9548               801.9429    Pep3660
#> 364           TRUE                 610.3683               609.8586    Pep3666
#> 365           TRUE                 738.3185               738.3327    Pep3670
#> 366           TRUE                 738.3185               738.3327    Pep3670
#> 367           TRUE                 644.3773               644.3667    Pep3672
#> 368           TRUE                 764.4821               763.9692    Pep2707
#> 369           TRUE                 798.9426               798.9551    Pep3688
#> 370           TRUE                 630.8036               630.3088    Pep3703
#> 371           TRUE                 675.3737               675.3735    Pep3713
#> 372           TRUE                 522.9703               522.9778    Pep3721
#> 373           TRUE                 774.4184               774.4092    Pep3521
#> 374           TRUE                 879.0797               878.7581    Pep3809
#> 375           TRUE                 879.0797               878.7581    Pep3809
#> 376           TRUE                 879.0797               878.7581    Pep3809
#> 377           TRUE                 782.1797               781.9219    Pep3813
#> 378           TRUE                 762.7695               762.7702    Pep3826
#> 379           TRUE                 601.8621               601.3510     Pep671
#> 380           TRUE                 850.4474               850.4537    Pep3854
#> 381           TRUE                 831.9478               831.9455    Pep3863
#> 382           TRUE                 831.9478               831.9410    Pep3864
#> 383           TRUE                 790.6985               790.3746    Pep3866
#> 384           TRUE                 790.6985               790.3746    Pep3866
#> 385           TRUE                 790.6985               790.3746    Pep3866
#> 386           TRUE                 790.6985               790.3746    Pep3866
#> 387           TRUE                 772.1263               772.1140    Pep3875
#> 388           TRUE                 628.2896               627.7928    Pep3980
#> 389           TRUE                 628.2896               628.2848    Pep3981
#> 390           TRUE                 859.1722               859.1754    Pep4010
#> 391           TRUE                 797.4781               797.4847    Pep4012
#> 392           TRUE                 720.4057               720.4188    Pep4036
#> 393           TRUE                1318.1162              1317.6335    Pep4041
#> 394           TRUE                1318.1162              1317.6335    Pep4041
#> 395           TRUE                1318.1162              1317.6335    Pep4041
#> 396           TRUE                 581.7797               581.2828    Pep4046
#> 397           TRUE                1106.9771              1106.9818    Pep4058
#> 398           TRUE                 828.5069               828.4982     Pep262
#> 399           TRUE                 814.7055               814.7028    Pep4078
#> 400           TRUE                 814.7055               814.7028    Pep4078
#> 401           TRUE                 433.2467               432.9058    Pep4094
#> 402           TRUE                 948.7693               948.7679    Pep4100
#> 403           TRUE                 545.9710               545.9678    Pep4128
#> 404           TRUE                 568.2605               567.7591    Pep4131
#> 405           TRUE                 824.7908               824.4660    Pep4173
#> 406           TRUE                 967.7726               967.5102    Pep4231
#> 407           TRUE                1114.9722              1114.4840    Pep4258
#> 408           TRUE                 743.6501               743.3251    Pep4258
#> 409           TRUE                 927.1102               926.9108    Pep4347
#> 410           TRUE                 927.1102               926.9108    Pep4347
#> 411           TRUE                 993.1279               993.1465    Pep4382
#> 412           TRUE                 993.1279               993.1465    Pep4382
#> 413           TRUE                 783.9506               783.9631    Pep3721
#> 414           TRUE                 751.1089               750.7607    Pep4572
#> 415           TRUE                 660.0679               659.7274    Pep4581
#> 416           TRUE                 996.1245               996.1376    Pep4670
#> 417           TRUE                 830.8630               830.8514    Pep4686
#> 418           TRUE                 830.8630               830.8514    Pep4686
#> 419           TRUE                 730.2786               729.7866    Pep4730
#> 420           TRUE                 933.5897               933.5828    Pep4800
#> 421           TRUE                 716.2834               715.7947    Pep4815
#> 422           TRUE                 716.2834               715.7947    Pep4815
#> 423           TRUE                 594.9217               594.5968    Pep4817
#> 424           TRUE                 891.8774               891.3916    Pep4817
#> 425           TRUE                1080.2325              1080.2321       Pep1
#> 426           TRUE                1002.2089              1002.2115       Pep2
#> 427           TRUE                1189.2836              1189.2800       Pep3
#> 428           TRUE                 960.5365               960.5365       Pep4
#> 429           TRUE                1264.3409              1264.3419       Pep5
#> 430           TRUE                1268.6429              1268.6501       Pep6
#> 431           TRUE                 960.5361               960.5365       Pep4
#> 432           TRUE                1048.0360              1048.0244       Pep7
#> 433           TRUE                1440.3066              1440.3011       Pep4
#> 434           TRUE                 946.9841               946.9715       Pep8
#> 435           TRUE                1056.0796              1056.0784       Pep9
#> 436           TRUE                1502.8140              1502.8137       Pep2
#> 437           TRUE                 850.8846               850.8752      Pep10
#> 438           TRUE                 846.0997               846.1025       Pep6
#> 439           TRUE                 514.5574               514.5576      Pep11
#> 440           TRUE                 845.9579               845.9492      Pep12
#> 441           TRUE                 703.3531               703.3463      Pep13
#> 442           TRUE                 782.4184               782.4099      Pep14
#> 443           TRUE                 771.3320               771.3328      Pep11
#> 444           TRUE                 892.2123               892.2118       Pep3
#> 445           TRUE                 594.3260               594.3198      Pep15
#> 446           TRUE                 594.3260               594.3198      Pep15
#> 447           TRUE                 799.4240               799.4223      Pep16
#> 448           TRUE                 739.7445               739.7460      Pep17
#> 449           TRUE                 989.5159               989.5120      Pep18
#> 450           TRUE                 989.5159               989.5120      Pep18
#> 451           TRUE                 484.5788               484.5794      Pep19
#> 452           TRUE                 672.3560               672.3494      Pep20
#> 453           TRUE                 652.8581               652.8515      Pep21
#> 454           TRUE                 548.8149               548.8091      Pep22
#> 455           TRUE                 650.8658               650.8590      Pep23
#> 456           TRUE                 515.6185               515.6122      Pep24
#> 457           TRUE                 624.3806               624.3716      Pep25
#> 458           TRUE                 566.8073               566.8015      Pep26
#> 459           TRUE                 720.8796               720.8721      Pep27
#> 460           TRUE                 862.9964               862.9989      Pep28
#> 461           TRUE                 421.7637               421.7583      Pep29
#> 462           TRUE                 559.2925               559.2855      Pep30
#> 463           TRUE                 631.3553               631.3486      Pep31
#> 464           TRUE                 587.6455               587.6441      Pep32
#> 465           TRUE                 632.8386               632.8323      Pep33
#> 466           TRUE                 786.1699               785.9069      Pep34
#> 467           TRUE                 730.3589               730.0154      Pep35
#> 468           TRUE                1182.1078              1182.1257      Pep36
#> 469           TRUE                 586.3240               585.9915      Pep37
#> 470           TRUE                 742.4689               741.9776      Pep38
#> 471           TRUE                 558.5939               558.5863      Pep39
#> 472           TRUE                 444.2848               444.2770      Pep40
#> 473           TRUE                 860.9728               860.9707      Pep41
#> 474           TRUE                 876.1528               876.1644      Pep42
#> 475           TRUE                 657.3670               657.3751      Pep42
#> 476           TRUE                 568.3089               568.3007      Pep43
#> 477           TRUE                 565.3546               565.3563      Pep44
#> 478           TRUE                 761.9722               761.4655      Pep45
#> 479           TRUE                 905.4996               904.9919      Pep46
#> 480           TRUE                 444.2848               444.2770      Pep40
#> 481           TRUE                 958.8664               958.8768      Pep47
#> 482           TRUE                 743.7321               743.7242      Pep48
#> 483           TRUE                 625.6424               625.3073      Pep49
#> 484           TRUE                 807.4677               807.4528      Pep50
#> 485           TRUE                 755.8845               755.3739      Pep51
#> 486           TRUE                 750.4090               750.3976      Pep52
#> 487           TRUE                 473.7609               473.7569      Pep53
#> 488           TRUE                 523.8267               523.3225      Pep54
#> 489           TRUE                 714.7225               714.3901      Pep55
#> 490           TRUE                 625.3922               625.3913      Pep56
#> 491           TRUE                 549.9599               549.9494      Pep57
#> 492           TRUE                 767.4406               767.4354      Pep58
#> 493           TRUE                 876.1538               876.1644      Pep42
#> 494           TRUE                1161.2738              1160.9458      Pep59
#> 495           TRUE                 713.9241               713.9169      Pep60
#> 496           TRUE                 713.9241               713.4305      Pep61
#> 497           TRUE                 878.4410               878.4409      Pep62
#> 498           TRUE                 806.9512               806.9545      Pep63
#> 499           TRUE                 573.6639               573.6543      Pep64
#> 500           TRUE                 431.9030               431.9034      Pep65
#> 501           TRUE                 660.0114               660.0104      Pep18
#> 502           TRUE                 660.0114               660.0104      Pep18
#> 503           TRUE                 420.9869               420.9868      Pep66
#> 504           TRUE                 951.5193               951.5083      Pep67
#> 505           TRUE                 745.0565               745.0660      Pep68
#> 506           TRUE                 511.9637               511.9594      Pep58
#> 507           TRUE                 486.0356               485.7757      Pep69
#> 508           TRUE                 624.3649               623.8620      Pep70
#> 509           TRUE                 480.5240               480.2694      Pep71
#> 510           TRUE                 796.9630               796.9589      Pep72
#> 511           TRUE                 443.2655               443.2668      Pep73
#> 512           TRUE                 677.3735               677.3835      Pep74
#> 513           TRUE                 892.4957               892.2357      Pep75
#> 514           TRUE                 643.7198               643.3740      Pep76
#> 515           TRUE                 639.3805               638.8891    Pep1100
#> 516           TRUE                 564.3461               563.8382      Pep78
#> 517           TRUE                 405.9120               405.9083      Pep79
#> 518           TRUE                 642.7025               642.6949      Pep80
#> 519           TRUE                 677.4128               677.4073      Pep81
#> 520           TRUE                 680.8738               680.3726      Pep82
#> 521           TRUE                 603.8628               603.8569      Pep83
#> 522           TRUE                 881.1528               881.1467      Pep84
#> 523           TRUE                 609.6709               609.6605      Pep85
#> 524           TRUE                 523.3011               522.7991      Pep86
#> 525           TRUE                 408.3852               408.2150      Pep87
#> 526           TRUE                 652.3517               652.3618      Pep88
#> 527           TRUE                 610.0068               609.9966      Pep89
#> 528           TRUE                 419.5750               419.5719      Pep90
#> 529           TRUE                 752.3796               752.3937      Pep91
#> 530           TRUE                1021.1794              1021.1682      Pep92
#> 531           TRUE                 643.9808               643.6586      Pep93
#> 532           TRUE                 488.2708               487.9356      Pep94
#> 533           TRUE                 890.4904               890.4935      Pep95
#> 534           TRUE                 809.4467               809.2077      Pep96
#> 535           TRUE                 609.3176               608.8253      Pep97
#> 536           TRUE                 663.3721               663.0264      Pep98
#> 537           TRUE                1081.5394              1081.1923      Pep99
#> 538           TRUE                1081.5394              1081.1923      Pep99
#> 539           TRUE                 832.8006               832.4532     Pep100
#> 540           TRUE                 788.4062               788.4196      Pep36
#> 541           TRUE                 957.0233               956.7776     Pep101
#> 542           TRUE                 674.8908               674.3908     Pep102
#> 543           TRUE                 538.8263               538.8198     Pep103
#> 544           TRUE                 812.7852               812.7909     Pep104
#> 545           TRUE                 771.1079               771.1032     Pep105
#> 546           TRUE                 946.2054               946.2016     Pep106
#> 547           TRUE                1061.5662              1061.5500     Pep107
#> 548           TRUE                 606.0066               605.6831    Pep1130
#> 549           TRUE                 815.9484               815.9363     Pep109
#> 550           TRUE                 586.0108               585.6757     Pep110
#> 551           TRUE                1076.0770              1076.0730     Pep111
#> 552           TRUE                 560.3198               559.8125     Pep112
#> 553           TRUE                 428.7720               428.7718     Pep113
#> 554           TRUE                 432.7532               432.7529     Pep114
#> 555           TRUE                 412.2299               411.7327     Pep115
#> 556           TRUE                 430.7511               430.2534     Pep116
#> 557           TRUE                 545.3144               545.3118     Pep117
#> 558           TRUE                 499.2837               499.2917     Pep118
#> 559           TRUE                 736.3995               736.3988     Pep119
#> 560           TRUE                 517.8040               517.3099     Pep120
#> 561           TRUE                 417.5748               417.2359     Pep121
#> 562           TRUE                 637.6839               637.3547     Pep122
#> 563           TRUE                 781.4622               781.4749     Pep123
#> 564           TRUE                 439.2667               438.9278     Pep124
#> 565           TRUE                1081.5894              1081.5911     Pep125
#> 566           TRUE                 727.3932               727.1445     Pep126
#> 567           TRUE                 769.9150               769.9244     Pep127
#> 568           TRUE                 829.4614               829.4540     Pep128
#> 569           TRUE                 770.3771               769.8654     Pep129
#> 570           TRUE                 690.7142               690.7152     Pep130
#> 571           TRUE                 910.9631               910.4709     Pep131
#> 572           TRUE                 767.7756               767.7673     Pep132
#> 573           TRUE                 900.5014               900.4922     Pep133
#> 574           TRUE                 485.0392               484.7864     Pep134
#> 575           TRUE                 752.9164               752.4063     Pep135
#> 576           TRUE                 618.8438               618.8328    Pep1156
#> 577           TRUE                 454.5970               454.2642     Pep137
#> 578           TRUE                 615.8358               615.3279     Pep138
#> 579           TRUE                1161.2452              1160.9122     Pep139
#> 580           TRUE                 610.3519               610.3583     Pep140
#> 581           TRUE                 795.4561               795.1130     Pep141
#> 582           TRUE                 671.0246               670.6934     Pep142
#> 583           TRUE                 571.9920               571.6530     Pep143
#> 584           TRUE                1026.2172              1026.2120     Pep144
#> 585           TRUE                 766.4742               765.9581     Pep145
#> 586           TRUE                 813.7750               813.4297     Pep146
#> 587           TRUE                 677.8740               677.3821     Pep147
#> 588           TRUE                 456.3003               456.2949     Pep148
#> 589           TRUE                 466.6054               466.6002     Pep149
#> 590           TRUE                 567.3370               567.3306     Pep150
#> 591           TRUE                 677.0342               676.6918     Pep151
#> 592           TRUE                 742.3892               742.3976     Pep152
#> 593           TRUE                 849.8112               849.8054     Pep153
#> 594           TRUE                 780.7706               780.7629     Pep154
#> 595           TRUE                 621.8690               621.8619     Pep155
#> 596           TRUE                1026.0471              1025.5286     Pep156
#> 597           TRUE                 963.0499               962.5524     Pep157
#> 598           TRUE                 585.6938               585.3589     Pep158
#> 599           TRUE                 758.3986               758.4122     Pep159
#> 600           TRUE                 756.8957               756.3930     Pep160
#> 601           TRUE                 686.0615               686.0543     Pep161
#> 602           TRUE                1173.3232              1172.9868     Pep162
#> 603           TRUE                 680.3875               679.8806    Pep1180
#> 604           TRUE                 980.0629               980.0624     Pep164
#> 605           TRUE                 423.2661               423.2638     Pep165
#> 606           TRUE                 622.0142               622.0085     Pep166
#> 607           TRUE                 948.9837               948.9838     Pep167
#> 608           TRUE                 740.9128               740.9174     Pep168
#> 609           TRUE                 739.9074               739.3937    Pep1185
#> 610           TRUE                 568.6729               568.3348     Pep170
#> 611           TRUE                 913.1814               913.1700     Pep171
#> 612           TRUE                 829.4702               829.1286     Pep172
#> 613           TRUE                 675.3452               675.3441     Pep173
#> 614           TRUE                 839.1069               839.1184     Pep174
#> 615           TRUE                 585.3548               585.0126     Pep175
#> 616           TRUE                 764.8995               764.4031     Pep176
#> 617           TRUE                 582.8153               582.5546     Pep177
#> 618           TRUE                 993.0717               992.5867     Pep178
#> 619           TRUE                 630.9894               631.0002     Pep179
#> 620           TRUE                 559.3495               559.0053     Pep180
#> 621           TRUE                1009.5360              1009.5187     Pep181
#> 622           TRUE                 837.7004               837.7047     Pep182
#> 623           TRUE                 508.8068               508.8016     Pep183
#> 624           TRUE                 825.9390               825.9264     Pep184
#> 625           TRUE                 440.7636               440.7612     Pep185
#> 626           TRUE                 916.4879               916.4819     Pep186
#> 627           TRUE                 846.4733               846.4868     Pep187
#> 628           TRUE                 745.9438               745.4391     Pep188
#> 629           TRUE                 519.6145               519.6133     Pep189
#> 630           TRUE                1117.0822              1116.6016     Pep190
#> 631           TRUE                1117.0822              1117.0955      Pep68
#> 632           TRUE                 818.0804               817.7540     Pep191
#> 633           TRUE                 573.8722               573.3669     Pep192
#> 634           TRUE                 544.6738               544.6632     Pep193
#> 635           TRUE                 405.7163               405.2168     Pep194
#> 636           TRUE                 758.7664               758.4279     Pep195
#> 637           TRUE                 757.3981               757.3915     Pep196
#> 638           TRUE                 977.5794               977.0733     Pep197
#> 639           TRUE                 751.7540               751.7582     Pep198
#> 640           TRUE                 703.4033               702.8946     Pep199
#> 641           TRUE                 424.5502               424.2228     Pep200
#> 642           TRUE                 814.1021               813.7571     Pep201
#> 643           TRUE                 722.8734               722.8868     Pep202
#> 644           TRUE                 918.4931               917.9958     Pep203
#> 645           TRUE                 588.3745               587.8696     Pep204
#> 646           TRUE                 885.7368               885.4855     Pep205
#> 647           TRUE                 532.3163               531.8120    Pep1220
#> 648           TRUE                 518.8257               518.8349     Pep207
#> 649           TRUE                 591.9880               591.6600     Pep208
#> 650           TRUE                 646.3630               646.3665     Pep209
#> 651           TRUE                 444.2748               444.2697     Pep210
#> 652           TRUE                 762.0892               762.0915     Pep211
#> 653           TRUE                 467.2915               467.2907    Pep1226
#> 654           TRUE                 690.4158               690.4221     Pep212
#> 655           TRUE                1044.0551              1044.0367     Pep213
#> 656           TRUE                 650.0291               650.0252     Pep214
#> 657           TRUE                 816.4830               816.4821     Pep215
#> 658           TRUE                 816.4830               816.4821     Pep215
#> 659           TRUE                 702.7248               702.3931    Pep1232
#> 660           TRUE                 544.8253               544.8324     Pep217
#> 661           TRUE                 914.1098               914.1039     Pep218
#> 662           TRUE                 804.4306               804.4363     Pep219
#> 663           TRUE                 977.5998               977.5997     Pep220
#> 664           TRUE                1039.5278              1039.5413     Pep221
#> 665           TRUE                 906.1765               906.1885     Pep222
#> 666           TRUE                1044.5576              1044.0367     Pep213
#> 667           TRUE                 777.9432               777.9555     Pep224
#> 668           TRUE                1068.0460              1068.0602     Pep225
#> 669           TRUE                 694.6130               694.6172     Pep226
#> 670           TRUE                1104.0966              1104.0946     Pep119
#> 671           TRUE                 671.4174               671.0723     Pep227
#> 672           TRUE                 671.4174               671.0723     Pep227
#> 673           TRUE                 403.2540               403.2472     Pep228
#> 674           TRUE                1426.3973              1426.3866     Pep229
#> 675           TRUE                 656.9001               656.4034     Pep230
#> 676           TRUE                 670.3773               670.3870     Pep231
#> 677           TRUE                 530.3329               530.3248     Pep232
#> 678           TRUE                 649.7166               649.3934     Pep233
#> 679           TRUE                 838.4565               838.1188     Pep234
#> 680           TRUE                 696.7060               696.7197     Pep235
#> 681           TRUE                 598.3213               597.8113     Pep236
#> 682           TRUE                 568.8034               568.3040     Pep237
#> 683           TRUE                 508.8396               508.8330     Pep238
#> 684           TRUE                 978.0242               978.0391      Pep88
#> 685           TRUE                 664.8961               664.4071    Pep1255
#> 686           TRUE                 568.3389               568.0135     Pep240
#> 687           TRUE                 573.6583               573.3247     Pep241
#> 688           TRUE                 648.3654               648.3572     Pep242
#> 689           TRUE                 725.0600               725.0661     Pep243
#> 690           TRUE                 517.8012               517.8017     Pep244
#> 691           TRUE                 963.5510               963.5532     Pep245
#> 692           TRUE                 707.9438               707.9301     Pep246
#> 693           TRUE                 696.3735               696.3823     Pep247
#> 694           TRUE                 612.7169               612.3744     Pep248
#> 695           TRUE                 859.9913               859.9778      Pep64
#> 696           TRUE                 809.7531               809.7423     Pep249
#> 697           TRUE                 749.9543               749.4453     Pep250
#> 698           TRUE                 408.7426               408.7473     Pep251
#> 699           TRUE                 637.3179               636.9749     Pep252
#> 700           TRUE                 408.7702               408.7654     Pep253
#> 701           TRUE                1233.1495              1233.1538     Pep254
#> 702           TRUE                 900.0005               900.0054     Pep255
#> 703           TRUE                 562.3348               561.8428     Pep256
#> 704           TRUE                 943.1628               942.8455     Pep257
#> 705           TRUE                 644.8981               644.8891     Pep258
#> 706           TRUE                 549.2791               548.7803     Pep259
#> 707           TRUE                 659.7075               659.7133     Pep260
#> 708           TRUE                 795.1129               794.7715     Pep261
#> 709           TRUE                 414.2386               414.2385    Pep1278
#> 710           TRUE                 907.8176               907.4972     Pep263
#> 711           TRUE                 454.7530               454.2590     Pep264
#> 712           TRUE                 442.6074               442.2726     Pep265
#> 713           TRUE                1107.6549              1107.1343     Pep266
#> 714           TRUE                 582.0188               582.0116    Pep1283
#> 715           TRUE                 471.2862               470.9503     Pep268
#> 716           TRUE                 748.3923               748.3936     Pep269
#> 717           TRUE                 881.8198               881.8060     Pep270
#> 718           TRUE                 595.8212               595.8175     Pep271
#> 719           TRUE                 542.2842               542.2827     Pep272
#> 720           TRUE                 538.2851               537.9448     Pep273
#> 721           TRUE                1345.7480              1345.2488     Pep274
#> 722           TRUE                1137.3527              1137.3370     Pep275
#> 723           TRUE                 548.3321               547.9874     Pep276
#> 724           TRUE                 730.7545               730.7487     Pep277
#> 725           TRUE                 730.7545               730.4111     Pep278
#> 726           TRUE                1014.8587              1014.5397     Pep279
#> 727           TRUE                 850.5042               849.9897     Pep280
#> 728           TRUE                 768.8915               768.3907    Pep1297
#> 729           TRUE                1085.5994              1085.2491     Pep282
#> 730           TRUE                 880.9930               880.9827     Pep283
#> 731           TRUE                 451.7662               451.2594     Pep284
#> 732           TRUE                 850.4590               850.1259     Pep285
#> 733           TRUE                 467.0218               466.7668     Pep286
#> 734           TRUE                 559.8415               559.3400     Pep287
#> 735           TRUE                 722.4053               722.4087     Pep288
#> 736           TRUE                 592.8807               592.3748     Pep289
#> 737           TRUE                 611.9992               611.6768     Pep290
#> 738           TRUE                 614.8366               614.3389     Pep291
#> 739           TRUE                 791.7562               791.7655     Pep292
#> 740           TRUE                 556.7950               556.2914     Pep293
#> 741           TRUE                 869.8046               869.4852     Pep294
#> 742           TRUE                 767.4297               767.4255     Pep295
#> 743           TRUE                 837.4633               837.1323    Pep2301
#> 744           TRUE                 726.8967               726.6324     Pep297
#> 745           TRUE                 505.2982               504.7997     Pep298
#> 746           TRUE                 897.9770               897.9897     Pep299
#> 747           TRUE                 700.8710               700.8786     Pep300
#> 748           TRUE                 746.9196               746.4103     Pep301
#> 749           TRUE                 595.3145               594.8202     Pep302
#> 750           TRUE                 566.6321               566.2898     Pep303
#> 751           TRUE                1053.0610              1053.0582     Pep304
#> 752           TRUE                 511.2949               511.2987     Pep305
#> 753           TRUE                 788.7610               788.7488     Pep306
#> 754           TRUE                 504.7797               504.7784     Pep307
#> 755           TRUE                 652.0200               652.0325     Pep308
#> 756           TRUE                 651.3710               651.3622     Pep309
#> 757           TRUE                 453.9293               453.9334     Pep310
#> 758           TRUE                 859.1163               859.1052     Pep311
#> 759           TRUE                 839.7608               839.7477     Pep312
#> 760           TRUE                 759.1639               759.1555     Pep313
#> 761           TRUE                 894.1403               894.1409     Pep314
#> 762           TRUE                 574.9866               574.6614     Pep315
#> 763           TRUE                 952.5284               952.5219     Pep316
#> 764           TRUE                 497.2984               497.2956     Pep317
#> 765           TRUE                 561.8138               561.8190     Pep318
#> 766           TRUE                 893.6937               893.7043    Pep1331
#> 767           TRUE                 790.4382               790.4263     Pep320
#> 768           TRUE                 845.1262               845.1414    Pep1333
#> 769           TRUE                 652.6859               652.3438     Pep322
#> 770           TRUE                 575.2975               574.9579     Pep323
#> 771           TRUE                 903.4864               903.4963     Pep324
#> 772           TRUE                 852.0015               851.4929     Pep325
#> 773           TRUE                 673.0280               673.0253     Pep326
#> 774           TRUE                1025.5186              1025.0184     Pep327
#> 775           TRUE                 637.0142               636.6718     Pep328
#> 776           TRUE                 649.8405               649.8393     Pep329
#> 777           TRUE                1137.1042              1136.8499     Pep330
#> 778           TRUE                 648.0623               648.0539     Pep331
#> 779           TRUE                 536.3096               536.3046     Pep332
#> 780           TRUE                 659.3939               659.0652     Pep333
#> 781           TRUE                 851.9915               851.9905     Pep334
#> 782           TRUE                 686.3806               686.0481     Pep335
#> 783           TRUE                 708.0798               708.0661     Pep336
#> 784           TRUE                 566.3643               565.8539     Pep337
#> 785           TRUE                 765.4305               765.4263     Pep338
#> 786           TRUE                 667.4178               666.9036    Pep1348
#> 787           TRUE                 629.3327               628.9955     Pep340
#> 788           TRUE                 736.0593               736.0612     Pep341
#> 789           TRUE                 738.4017               738.3963     Pep342
#> 790           TRUE                 474.7796               474.7849     Pep343
#> 791           TRUE                 472.2734               472.2686     Pep344
#> 792           TRUE                1184.0991              1184.0790     Pep345
#> 793           TRUE                 665.4117               665.3998     Pep346
#> 794           TRUE                 509.3091               509.3125     Pep347
#> 795           TRUE                 810.4523               810.4612     Pep348
#> 796           TRUE                 936.0301               936.0468     Pep349
#> 797           TRUE                 983.5127               983.1589     Pep350
#> 798           TRUE                 794.9424               794.9419     Pep351
#> 799           TRUE                 706.9318               706.9329     Pep352
#> 800           TRUE                 503.2896               503.2851     Pep353
#> 801           TRUE                 851.1240               851.1282     Pep354
#> 802           TRUE                 482.2965               482.2903     Pep355
#> 803           TRUE                 676.0464               676.0349     Pep356
#> 804           TRUE                 652.0550               651.7180     Pep197
#> 805           TRUE                 871.9795               871.9663    Pep1364
#> 806           TRUE                 807.8332               807.4952     Pep358
#> 807           TRUE                 526.3360               526.3431     Pep359
#> 808           TRUE                 963.0139               962.5229     Pep360
#> 809           TRUE                1026.5359              1026.5336     Pep361
#> 810           TRUE                 861.9741               861.4813     Pep362
#> 811           TRUE                1068.0565              1067.5712     Pep363
#> 812           TRUE                 552.3246               551.8144     Pep364
#> 813           TRUE                 637.5997               637.3413     Pep365
#> 814           TRUE                 607.6655               607.6578     Pep366
#> 815           TRUE                 904.1161               903.7753     Pep367
#> 816           TRUE                 610.8400               610.3384     Pep368
#> 817           TRUE                 635.0541               634.7083     Pep369
#> 818           TRUE                 575.2957               575.2936     Pep370
#> 819           TRUE                1064.9141              1064.9174     Pep371
#> 820           TRUE                 489.8601               489.8583     Pep372
#> 821           TRUE                 595.0021               595.0053     Pep373
#> 822           TRUE                 950.4807               950.2387     Pep374
#> 823           TRUE                 937.0067               936.5135     Pep375
#> 824           TRUE                 836.0983               835.7580     Pep376
#> 825           TRUE                 962.5082               962.5049     Pep377
#> 826           TRUE                 701.9096               701.9232     Pep378
#> 827           TRUE                 610.9793               610.9713     Pep379
#> 828           TRUE                 589.0710               588.8222     Pep380
#> 829           TRUE                 698.3531               698.0309     Pep381
#> 830           TRUE                 447.2389               447.2386     Pep382
#> 831           TRUE                 991.0051               991.0182     Pep383
#> 832           TRUE                 656.6954               656.3693     Pep384
#> 833           TRUE                 755.9030               755.8932     Pep385
#> 834           TRUE                 761.7492               761.7375     Pep386
#> 835           TRUE                 651.7073               651.7023     Pep387
#> 836           TRUE                 665.8625               665.3527     Pep388
#> 837           TRUE                 558.3344               557.8276     Pep389
#> 838           TRUE                 637.8115               637.8155     Pep390
#> 839           TRUE                1024.5823              1024.0710     Pep391
#> 840           TRUE                 670.0494               669.7126     Pep392
#> 841           TRUE                 818.1492               817.8234    Pep1398
#> 842           TRUE                 865.5066               865.5073    Pep2392
#> 843           TRUE                 786.9393               786.9303     Pep395
#> 844           TRUE                 499.8194               499.8145     Pep396
#> 845           TRUE                 419.8845               419.8911     Pep397
#> 846           TRUE                 489.3040               488.7966     Pep398
#> 847           TRUE                 963.5088               963.5031     Pep399
#> 848           TRUE                 715.0753               715.0634     Pep400
#> 849           TRUE                1194.0970              1193.6016     Pep401
#> 850           TRUE                 779.0990               779.0989     Pep402
#> 851           TRUE                1131.5885              1131.1072     Pep403
#> 852           TRUE                 795.9395               795.4509     Pep404
#> 853           TRUE                1050.5851              1050.0764     Pep405
#> 854           TRUE                 508.7926               508.7871     Pep406
#> 855           TRUE                 486.6056               486.6048    Pep1411
#> 856           TRUE                 643.3966               642.9003     Pep408
#> 857           TRUE                 468.5842               468.5919     Pep409
#> 858           TRUE                 830.1227               829.7782     Pep410
#> 859           TRUE                 476.2848               475.9561      Pep61
#> 860           TRUE                 691.7105               691.7057     Pep411
#> 861           TRUE                1050.5743              1050.0764     Pep405
#> 862           TRUE                 606.0085               605.6757     Pep412
#> 863           TRUE                 616.8730               616.8704     Pep413
#> 864           TRUE                 755.9062               755.8934     Pep414
#> 865           TRUE                1117.0861              1117.0955      Pep68
#> 866           TRUE                 609.6929               609.6939     Pep415
#> 867           TRUE                 888.0026               887.4969     Pep416
#> 868           TRUE                 748.7429               748.4036     Pep417
#> 869           TRUE                 824.0859               823.7518     Pep418
#> 870           TRUE                 637.8745               637.3781     Pep419
#> 871           TRUE                 630.3217               629.9810     Pep420
#> 872           TRUE                 568.2947               567.7882     Pep421
#> 873           TRUE                 571.0427               570.7031     Pep422
#> 874           TRUE                 547.3014               546.7991     Pep423
#> 875           TRUE                1302.1816              1302.2024     Pep424
#> 876           TRUE                 815.7708               815.4333     Pep425
#> 877           TRUE                 698.0217               697.6982     Pep426
#> 878           TRUE                1034.0488              1034.0690     Pep427
#> 879           TRUE                 495.6063               495.6087     Pep428
#> 880           TRUE                 725.0476               725.0505     Pep429
#> 881           TRUE                 776.8011               776.7969     Pep430
#> 882           TRUE                 681.3640               681.0194     Pep431
#> 883           TRUE                 661.8790               661.3853     Pep432
#> 884           TRUE                 592.0169               592.0101     Pep433
#> 885           TRUE                 486.9528               486.6218     Pep434
#> 886           TRUE                 580.3426               579.8375     Pep435
#> 887           TRUE                 591.3277               591.0026     Pep436
#> 888           TRUE                 652.0668               652.0605     Pep437
#> 889           TRUE                 679.9028               679.8918     Pep438
#> 890           TRUE                 538.9865               538.6456     Pep439
#> 891           TRUE                1003.5515              1003.5608     Pep440
#> 892           TRUE                 587.0427               586.7090     Pep441
#> 893           TRUE                 735.4213               734.9208     Pep442
#> 894           TRUE                 674.0452               673.7042     Pep443
#> 895           TRUE                 655.0330               655.0288     Pep444
#> 896           TRUE                 777.9471               777.9555     Pep224
#> 897           TRUE                 540.9523               540.6262     Pep445
#> 898           TRUE                 644.8777               644.6224     Pep446
#> 899           TRUE                1272.6658              1272.1869     Pep447
#> 900           TRUE                1272.6658              1272.6716     Pep448
#> 901           TRUE                 629.8620               629.8705     Pep449
#> 902           TRUE                 723.3779               722.8868     Pep202
#> 903           TRUE                 453.7916               453.2820     Pep450
#> 904           TRUE                 453.7916               453.2820     Pep450
#> 905           TRUE                 802.4496               802.4501     Pep451
#> 906           TRUE                 858.9991               859.0040     Pep452
#> 907           TRUE                 462.7825               462.7743    Pep1458
#> 908           TRUE                 685.8822               685.8862     Pep454
#> 909           TRUE                 903.9931               903.9812     Pep455
#> 910           TRUE                 775.9247               775.6648    Pep1460
#> 911           TRUE                 508.2839               507.9565     Pep457
#> 912           TRUE                1005.0614              1005.0569     Pep458
#> 913           TRUE                 612.0153               612.0151     Pep459
#> 914           TRUE                 874.4558               874.4684     Pep460
#> 915           TRUE                 614.8203               614.3102     Pep461
#> 916           TRUE                 418.2402               417.7413     Pep462
#> 917           TRUE                 489.3048               488.8062     Pep463
#> 918           TRUE                 912.9733               912.9603     Pep464
#> 919           TRUE                1343.7378              1343.7417    Pep1468
#> 920           TRUE                 793.1606               793.1723     Pep466
#> 921           TRUE                 793.1606               793.1723     Pep466
#> 922           TRUE                 591.6795               591.3478     Pep467
#> 923           TRUE                 493.2742               493.2749     Pep468
#> 924           TRUE                1043.5160              1043.5140     Pep469
#> 925           TRUE                 532.2859               531.9464     Pep470
#> 926           TRUE                1356.1654              1356.1881     Pep471
#> 927           TRUE                 518.9592               518.6230    Pep1474
#> 928           TRUE                 566.3599               565.8539     Pep337
#> 929           TRUE                 610.9763               610.9808     Pep473
#> 930           TRUE                 489.6319               489.2998     Pep474
#> 931           TRUE                 556.8036               556.8093     Pep475
#> 932           TRUE                1425.2750              1425.2708     Pep476
#> 933           TRUE                 442.9343               442.9407     Pep477
#> 934           TRUE                 704.8844               704.3944     Pep478
#> 935           TRUE                 406.9002               406.8949     Pep479
#> 936           TRUE                 869.9899               869.9892     Pep480
#> 937           TRUE                 983.3058               983.0643     Pep481
#> 938           TRUE                1155.1061              1154.5913     Pep482
#> 939           TRUE                 505.2958               504.7941     Pep483
#> 940           TRUE                 585.8297               585.8408     Pep484
#> 941           TRUE                 637.3701               637.3781     Pep485
#> 942           TRUE                 405.2449               405.2476     Pep486
#> 943           TRUE                 809.1619               809.1584     Pep487
#> 944           TRUE                1358.2803              1358.2570     Pep488
#> 945           TRUE                 451.5748               451.2458     Pep489
#> 946           TRUE                 634.6815               634.3391     Pep490
#> 947           TRUE                 471.9466               471.9482     Pep491
#> 948           TRUE                 530.7997               530.3082     Pep492
#> 949           TRUE                1085.9440              1085.9332     Pep493
#> 950           TRUE                 829.3953               829.3972     Pep494
#> 951           TRUE                 648.4279               648.4228    Pep1496
#> 952           TRUE                 675.7120               675.7031     Pep496
#> 953           TRUE                 767.0944               767.0854     Pep497
#> 954           TRUE                 510.8300               510.8249     Pep498
#> 955           TRUE                1050.2771              1050.2738     Pep499
#> 956           TRUE                 615.8743               615.8682     Pep500
#> 957           TRUE                 463.6011               463.5946     Pep501
#> 958           TRUE                 408.7499               408.2516     Pep502
#> 959           TRUE                 701.3746               701.3757     Pep503
#> 960           TRUE                 693.0473               693.0341     Pep504
#> 961           TRUE                 844.9506               844.4649     Pep505
#> 962           TRUE                 923.0383               922.5538     Pep506
#> 963           TRUE                 761.4079               761.0815     Pep507
#> 964           TRUE                 639.6275               639.6149     Pep508
#> 965           TRUE                 649.3450               649.0197     Pep509
#> 966           TRUE                 703.3821               703.0566     Pep510
#> 967           TRUE                 637.8708               637.3781     Pep419
#> 968           TRUE                 436.2738               436.2772     Pep511
#> 969           TRUE                 918.8151               918.8083     Pep512
#> 970           TRUE                 725.6680               725.4077     Pep513
#> 971           TRUE                1267.3053              1266.9481     Pep514
#> 972           TRUE                 462.9372               462.5964     Pep515
#> 973           TRUE                 486.0304               485.7757      Pep69
#> 974           TRUE                 708.0455               707.7241     Pep516
#> 975           TRUE                 771.9405               771.4313     Pep517
#> 976           TRUE                 872.4843               872.4916     Pep518
#> 977           TRUE                 541.3101               540.8103     Pep519
#> 978           TRUE                 983.3009               983.0643     Pep481
#> 979           TRUE                 828.9697               828.9590     Pep520
#> 980           TRUE                1151.2595              1151.2579     Pep521
#> 981           TRUE                 747.4204               747.4165     Pep522
#> 982           TRUE                 604.3754               604.3671     Pep228
#> 983           TRUE                 736.3911               736.3995     Pep523
#> 984           TRUE                 550.3152               550.3222     Pep524
#> 985           TRUE                 632.6790               632.6852     Pep525
#> 986           TRUE                 616.3613               615.8513     Pep526
#> 987           TRUE                 779.8954               779.9077     Pep221
#> 988           TRUE                 537.3201               537.3273     Pep527
#> 989           TRUE                 955.1617               954.8273     Pep528
#> 990           TRUE                 627.8184               627.3286     Pep529
#> 991           TRUE                 863.9689               863.7249     Pep530
#> 992           TRUE                 523.6064               523.6071     Pep531
#> 993           TRUE                 541.2855               541.0443     Pep532
#> 994           TRUE                 600.3959               600.3892     Pep533
#> 995           TRUE                 958.0252               957.5258     Pep534
#> 996           TRUE                1233.3406              1233.0013    Pep1538
#> 997           TRUE                 875.4787               874.9625     Pep536
#> 998           TRUE                 875.4787               874.9625     Pep536
#> 999           TRUE                 678.3400               678.3494     Pep537
#> 1000          TRUE                 696.7078               696.3699     Pep538
#> 1001          TRUE                 857.4641               857.4658     Pep539
#> 1002          TRUE                 782.7407               782.3972     Pep540
#> 1003          TRUE                 701.8942               701.9010     Pep541
#> 1004          TRUE                 522.8140               522.3071     Pep542
#> 1005          TRUE                 501.3295               500.8243    Pep1547
#> 1006          TRUE                 897.9669               897.4683     Pep544
#> 1007          TRUE                 910.8442               910.5263     Pep545
#> 1008          TRUE                 424.7517               424.2485     Pep546
#> 1009          TRUE                 429.3011               428.8012     Pep547
#> 1010          TRUE                 704.3683               703.8730     Pep548
#> 1011          TRUE                 864.4940               863.9962     Pep549
#> 1012          TRUE                 628.0014               627.9955     Pep550
#> 1013          TRUE                 812.7909               812.7909     Pep104
#> 1014          TRUE                1037.5140              1037.0208    Pep1556
#> 1015          TRUE                 852.5059               851.9985     Pep170
#> 1016          TRUE                 731.0871               730.7487     Pep277
#> 1017          TRUE                 705.4009               705.3948     Pep552
#> 1018          TRUE                 727.7277               727.7357     Pep553
#> 1019          TRUE                 593.8655               593.8726     Pep554
#> 1020          TRUE                 471.2531               471.2456     Pep555
#> 1021          TRUE                 637.3818               637.3781     Pep556
#> 1022          TRUE                 826.9410               826.9526     Pep557
#> 1023          TRUE                 453.7679               453.2638     Pep558
#> 1024          TRUE                 842.7672               842.4344     Pep559
#> 1025          TRUE                 842.7672               842.4342     Pep560
#> 1026          TRUE                 678.8665               678.8682     Pep561
#> 1027          TRUE                 431.7778               431.7721    Pep1568
#> 1028          TRUE                 751.9248               751.4102     Pep563
#> 1029          TRUE                 648.6817               648.3354     Pep564
#> 1030          TRUE                 644.3751               643.8624     Pep565
#> 1031          TRUE                1023.0916              1022.5742     Pep566
#> 1032          TRUE                 471.9452               471.6173     Pep567
#> 1033          TRUE                 552.3180               551.9836     Pep568
#> 1034          TRUE                 676.6810               676.3517     Pep569
#> 1035          TRUE                 628.8859               628.8906     Pep570
#> 1036          TRUE                 650.3456               650.3424     Pep571
#> 1037          TRUE                 496.3191               495.8083     Pep572
#> 1038          TRUE                 516.8165               516.3147     Pep573
#> 1039          TRUE                 883.1359               882.8184     Pep574
#> 1040          TRUE                1043.0190              1043.0253     Pep575
#> 1041          TRUE                 695.8514               695.8630    Pep1582
#> 1042          TRUE                 939.7308               939.4659    Pep1583
#> 1043          TRUE                 503.7815               503.7876     Pep578
#> 1044          TRUE                 900.9500               900.9511     Pep579
#> 1045          TRUE                1195.1681              1194.6517     Pep580
#> 1046          TRUE                 401.5870               401.5876    Pep1586
#> 1047          TRUE                 991.0580               991.0776     Pep582
#> 1048          TRUE                 969.5225               969.1903     Pep126
#> 1049          TRUE                1162.9257              1162.9337     Pep583
#> 1050          TRUE                 852.1266               852.1389     Pep584
#> 1051          TRUE                 829.7607               829.4348     Pep585
#> 1052          TRUE                 471.9718               471.6356     Pep586
#> 1053          TRUE                 630.3339               629.8333     Pep587
#> 1054          TRUE                 630.3339               630.3229     Pep588
#> 1055          TRUE                 666.7259               666.3812     Pep589
#> 1056          TRUE                1088.1061              1088.1158     Pep590
#> 1057          TRUE                 842.7996               842.4700     Pep591
#> 1058          TRUE                 778.7603               778.7510     Pep592
#> 1059          TRUE                1213.6394              1213.6562     Pep593
#> 1060          TRUE                 417.9904               417.7452     Pep594
#> 1061          TRUE                1142.0868              1141.5980    Pep1600
#> 1062          TRUE                 467.7878               467.2907     Pep596
#> 1063          TRUE                 701.8793               701.8755     Pep597
#> 1064          TRUE                 875.4615               874.9576     Pep598
#> 1065          TRUE                 580.8423               580.8416     Pep599
#> 1066          TRUE                 918.4866               918.4756     Pep600
#> 1067          TRUE                 838.1265               837.7889     Pep601
#> 1068          TRUE                 989.2562               989.0013     Pep602
#> 1069          TRUE                 552.3502               552.3434     Pep603
#> 1070          TRUE                 545.7870               545.7913     Pep604
#> 1071          TRUE                 663.8766               663.8781     Pep605
#> 1072          TRUE                 644.8577               644.6118     Pep606
#> 1073          TRUE                 621.6619               621.3153     Pep607
#> 1074          TRUE                 637.3785               636.8765     Pep608
#> 1075          TRUE                 578.8195               578.8253     Pep609
#> 1076          TRUE                 890.8199               890.4935      Pep95
#> 1077          TRUE                 447.2607               447.2580     Pep610
#> 1078          TRUE                1049.5725              1049.5632     Pep611
#> 1079          TRUE                 643.0192               642.6830     Pep612
#> 1080          TRUE                 503.3125               502.8036     Pep613
#> 1081          TRUE                 485.7647               485.2649     Pep614
#> 1082          TRUE                 903.4859               903.4976    Pep2605
#> 1083          TRUE                1266.9756              1266.6575     Pep616
#> 1084          TRUE                 571.3337               570.8411     Pep617
#> 1085          TRUE                 784.1708               783.9188     Pep618
#> 1086          TRUE                 790.3957               790.3988     Pep619
#> 1087          TRUE                 648.3682               647.8762     Pep620
#> 1088          TRUE                1023.9082              1023.5741     Pep621
#> 1089          TRUE                 581.3524               580.8542     Pep622
#> 1090          TRUE                 794.4205               794.4225     Pep623
#> 1091          TRUE                 592.3367               592.3402     Pep624
#> 1092          TRUE                 696.0146               695.6705     Pep625
#> 1093          TRUE                 575.3403               575.3356     Pep626
#> 1094          TRUE                 668.3583               668.0363     Pep627
#> 1095          TRUE                 954.0204               954.0034     Pep628
#> 1096          TRUE                 887.4788               886.9867     Pep629
#> 1097          TRUE                 703.0572               702.7302     Pep630
#> 1098          TRUE                 615.3650               615.0194     Pep631
#> 1099          TRUE                 481.7587               481.7619     Pep632
#> 1100          TRUE                 799.9529               799.4421     Pep633
#> 1101          TRUE                 551.7999               551.2993     Pep634
#> 1102          TRUE                 736.0659               736.0612     Pep341
#> 1103          TRUE                 667.8848               667.8749     Pep635
#> 1104          TRUE                 416.7402               416.7378     Pep636
#> 1105          TRUE                 654.1136               654.1037     Pep637
#> 1106          TRUE                1060.7848              1060.7979     Pep638
#> 1107          TRUE                 646.8421               646.8483    Pep1642
#> 1108          TRUE                 866.4564               866.4540     Pep640
#> 1109          TRUE                 865.1132               864.7807    Pep1644
#> 1110          TRUE                 533.7953               533.7917    Pep1645
#> 1111          TRUE                 598.3353               598.3251     Pep643
#> 1112          TRUE                 935.5024               935.5117     Pep644
#> 1113          TRUE                 582.6492               582.6479     Pep645
#> 1114          TRUE                 640.6967               640.3581     Pep646
#> 1115          TRUE                 901.0130               901.0076    Pep1650
#> 1116          TRUE                 480.7733               480.7647     Pep648
#> 1117          TRUE                 796.1331               796.1395     Pep649
#> 1118          TRUE                 737.0945               736.7502    Pep1289
#> 1119          TRUE                1502.8025              1502.2800     Pep651
#> 1120          TRUE                 941.5681               941.0676     Pep652
#> 1121          TRUE                 857.4570               857.1332     Pep653
#> 1122          TRUE                 427.8837               427.8911     Pep654
#> 1123          TRUE                 693.9285               693.9151     Pep655
#> 1124          TRUE                 491.9655               491.6356     Pep656
#> 1125          TRUE                 859.4608               859.4763     Pep657
#> 1126          TRUE                1053.9021              1053.8955     Pep658
#> 1127          TRUE                 581.3538               581.3531     Pep659
#> 1128          TRUE                 741.9721               741.9581     Pep660
#> 1129          TRUE                 607.3380               606.9951     Pep661
#> 1130          TRUE                 857.4743               857.4658     Pep539
#> 1131          TRUE                 914.0023               914.0042     Pep662
#> 1132          TRUE                 774.4018               774.4056     Pep663
#> 1133          TRUE                 541.8430               541.8489     Pep664
#> 1134          TRUE                 794.9639               794.9664     Pep665
#> 1135          TRUE                 860.7925               860.8075     Pep666
#> 1136          TRUE                 700.0478               699.7097     Pep667
#> 1137          TRUE                 725.4098               725.1499     Pep668
#> 1138          TRUE                 774.7392               774.7382     Pep669
#> 1139          TRUE                 460.2740               460.2772     Pep670
#> 1140          TRUE                 511.3178               510.8067    Pep1672
#> 1141          TRUE                 666.3972               666.4046     Pep672
#> 1142          TRUE                 681.8727               681.3739     Pep673
#> 1143          TRUE                 719.0446               718.7089     Pep674
#> 1144          TRUE                 954.4827               954.4954     Pep675
#> 1145          TRUE                 475.7909               475.2825     Pep676
#> 1146          TRUE                 965.4683               964.9843      Pep93
#> 1147          TRUE                 474.7723               474.2638    Pep1679
#> 1148          TRUE                 505.3225               504.8156     Pep678
#> 1149          TRUE                 915.0242               915.0087     Pep679
#> 1150          TRUE                 639.0190               638.6722     Pep680
#> 1151          TRUE                 639.0190               638.6722     Pep680
#> 1152          TRUE                 639.0190               638.6722     Pep680
#> 1153          TRUE                 723.0432               722.7052     Pep681
#> 1154          TRUE                 575.3204               574.8248    Pep1685
#> 1155          TRUE                 740.3807               739.8856     Pep683
#> 1156          TRUE                 628.3484               628.0872     Pep684
#> 1157          TRUE                1480.8209              1480.3254     Pep685
#> 1158          TRUE                 499.7804               499.7879     Pep686
#> 1159          TRUE                 495.9673               495.9598     Pep687
#> 1160          TRUE                 636.3806               636.0342     Pep688
#> 1161          TRUE                 593.9888               593.9882    Pep1690
#> 1162          TRUE                 541.8425               541.8489     Pep664
#> 1163          TRUE                 656.3579               656.3621     Pep690
#> 1164          TRUE                 708.7070               708.3586     Pep691
#> 1165          TRUE                 524.7772               524.7671     Pep692
#> 1166          TRUE                 867.9691               867.9540     Pep693
#> 1167          TRUE                 676.3744               676.1131    Pep1695
#> 1168          TRUE                 676.3744               676.1128    Pep1696
#> 1169          TRUE                1002.0511              1001.5381     Pep696
#> 1170          TRUE                 731.4446               731.4507     Pep697
#> 1171          TRUE                 469.7917               469.2901     Pep698
#> 1172          TRUE                 635.6075               635.6027     Pep699
#> 1173          TRUE                 712.0399               711.7026     Pep700
#> 1174          TRUE                 571.6533               571.3260     Pep701
#> 1175          TRUE                 890.8362               890.8286     Pep702
#> 1176          TRUE                 715.9216               715.4286     Pep703
#> 1177          TRUE                 864.4609               863.9654     Pep704
#> 1178          TRUE                 725.0544               724.7297    Pep1706
#> 1179          TRUE                 725.0544               725.0417    Pep1707
#> 1180          TRUE                 498.2645               498.2691     Pep706
#> 1181          TRUE                 596.6505               596.6444     Pep707
#> 1182          TRUE                 507.6347               507.3095     Pep708
#> 1183          TRUE                 466.2780               465.7726    Pep1711
#> 1184          TRUE                1327.2158              1327.2048     Pep710
#> 1185          TRUE                 599.3224               599.3245     Pep711
#> 1186          TRUE                 471.4990               471.2456     Pep712
#> 1187          TRUE                 651.3625               651.3534     Pep713
#> 1188          TRUE                 881.1693               880.8274     Pep714
#> 1189          TRUE                 533.3057               532.9738     Pep715
#> 1190          TRUE                 489.2859               489.2800    Pep1455
#> 1191          TRUE                 569.3026               569.2936     Pep717
#> 1192          TRUE                 412.2311               412.2316     Pep718
#> 1193          TRUE                 671.4439               670.9349    Pep1721
#> 1194          TRUE                 658.6815               658.6746    Pep1722
#> 1195          TRUE                 886.8143               886.8281     Pep721
#> 1196          TRUE                 804.4285               804.4286     Pep722
#> 1197          TRUE                 406.9117               406.5753    Pep1723
#> 1198          TRUE                 717.7205               717.7177     Pep111
#> 1199          TRUE                 758.9267               758.4274     Pep724
#> 1200          TRUE                 758.9267               758.9333     Pep725
#> 1201          TRUE                 962.1951               962.1970     Pep726
#> 1202          TRUE                 908.5069               907.9989     Pep727
#> 1203          TRUE                 786.9338               786.4286     Pep728
#> 1204          TRUE                 798.1136               798.1118     Pep729
#> 1205          TRUE                 573.6083               573.2845     Pep730
#> 1206          TRUE                 535.8243               535.3149     Pep731
#> 1207          TRUE                 677.3730               677.3696     Pep732
#> 1208          TRUE                 453.2475               453.2417     Pep733
#> 1209          TRUE                 645.8853               645.8801     Pep734
#> 1210          TRUE                 611.6828               611.3406     Pep735
#> 1211          TRUE                 787.9590               787.9571     Pep499
#> 1212          TRUE                 899.1454               899.1352     Pep736
#> 1213          TRUE                 996.5433               996.5458     Pep737
#> 1214          TRUE                 833.7944               833.8104     Pep738
#> 1215          TRUE                 815.4236               815.4363    Pep1739
#> 1216          TRUE                 935.5207               935.0263    Pep1740
#> 1217          TRUE                 783.4387               783.1864     Pep741
#> 1218          TRUE                 885.9787               885.7405     Pep742
#> 1219          TRUE                 780.1016               780.1129     Pep743
#> 1220          TRUE                 826.4614               826.4777     Pep744
#> 1221          TRUE                 514.7814               514.7911     Pep745
#> 1222          TRUE                 408.8928               408.5524     Pep746
#> 1223          TRUE                 800.1082               800.1067     Pep747
#> 1224          TRUE                 875.4538               875.4645     Pep748
#> 1225          TRUE                 461.2390               460.9103     Pep749
#> 1226          TRUE                 595.9990               595.9880     Pep750
#> 1227          TRUE                 707.4035               706.8908     Pep751
#> 1228          TRUE                 667.7128               667.3703     Pep752
#> 1229          TRUE                 453.7909               453.2946     Pep753
#> 1230          TRUE                 783.1199               783.1130    Pep1754
#> 1231          TRUE                1042.0897              1042.0833     Pep755
#> 1232          TRUE                 607.8772               607.3655     Pep756
#> 1233          TRUE                 795.4792               795.4780     Pep757
#> 1234          TRUE                 890.4792               890.4641     Pep758
#> 1235          TRUE                 582.2961               582.3011    Pep1759
#> 1236          TRUE                 501.8166               501.8120     Pep760
#> 1237          TRUE                 452.7723               452.2633     Pep761
#> 1238          TRUE                 576.3148               575.9763     Pep762
#> 1239          TRUE                 576.3148               576.3197     Pep763
#> 1240          TRUE                 435.2879               434.7886     Pep764
#> 1241          TRUE                 435.2879               434.7886     Pep764
#> 1242          TRUE                 911.9521               911.9557     Pep765
#> 1243          TRUE                 916.9841               916.9871     Pep766
#> 1244          TRUE                 589.8224               589.3198     Pep767
#> 1245          TRUE                 481.3137               481.3063     Pep768
#> 1246          TRUE                 834.0021               833.5138     Pep769
#> 1247          TRUE                 460.7807               460.2828     Pep770
#> 1248          TRUE                 605.3201               605.3168     Pep771
#> 1249          TRUE                 614.8367               614.5880     Pep772
#> 1250          TRUE                 827.9731               827.4810     Pep773
#> 1251          TRUE                 827.9731               827.4774     Pep774
#> 1252          TRUE                 926.8328               926.4970    Pep1775
#> 1253          TRUE                 676.0463               676.0371     Pep776
#> 1254          TRUE                 694.9088               694.4032     Pep777
#> 1255          TRUE                 717.4036               717.3916     Pep778
#> 1256          TRUE                 632.3598               632.3601     Pep779
#> 1257          TRUE                 667.8558               667.3592     Pep780
#> 1258          TRUE                 669.7067               669.7047     Pep781
#> 1259          TRUE                 786.4055               786.4206     Pep782
#> 1260          TRUE                 983.8547               983.5280     Pep783
#> 1261          TRUE                 651.0326               651.0372     Pep784
#> 1262          TRUE                 587.9907               587.6516     Pep785
#> 1263          TRUE                 897.5009               897.4875    Pep1784
#> 1264          TRUE                 503.2967               502.8036     Pep787
#> 1265          TRUE                 876.0120               875.5078     Pep788
#> 1266          TRUE                1005.0728              1005.0682    Pep1787
#> 1267          TRUE                 651.9097               651.8989    Pep1788
#> 1268          TRUE                 668.1205               668.1219      Pep95
#> 1269          TRUE                1035.2438              1035.2234     Pep791
#> 1270          TRUE                 876.0150               875.4972     Pep792
#> 1271          TRUE                 638.6984               638.6863     Pep793
#> 1272          TRUE                 748.4122               748.0853     Pep794
#> 1273          TRUE                 933.5178               933.5190    Pep1793
#> 1274          TRUE                1196.6698              1196.6641     Pep729
#> 1275          TRUE                 468.7943               468.5452    Pep1795
#> 1276          TRUE                1256.6885              1256.1798     Pep601
#> 1277          TRUE                 430.4539               430.4488     Pep797
#> 1278          TRUE                 776.6846               776.4400     Pep798
#> 1279          TRUE                 519.8300               519.3289     Pep799
#> 1280          TRUE                 787.8940               787.4077     Pep800
#> 1281          TRUE                 728.0637               728.0698     Pep801
#> 1282          TRUE                 684.9409               684.4333     Pep802
#> 1283          TRUE                 810.1125               809.7811    Pep1802
#> 1284          TRUE                1248.1545              1248.1448     Pep804
#> 1285          TRUE                 608.8646               608.3641     Pep805
#> 1286          TRUE                1075.5980              1075.6021     Pep806
#> 1287          TRUE                 424.7656               424.7643     Pep807
#> 1288          TRUE                1003.2186              1003.2160     Pep808
#> 1289          TRUE                1078.6069              1078.6221    Pep1091
#> 1290          TRUE                 957.9681               957.9617     Pep810
#> 1291          TRUE                 825.9419               825.9385     Pep811
#> 1292          TRUE                 516.2813               515.7856     Pep812
#> 1293          TRUE                 461.2719               460.7692     Pep813
#> 1294          TRUE                 588.3780               588.3722    Pep1809
#> 1295          TRUE                 466.2815               465.7726    Pep1810
#> 1296          TRUE                 675.0376               675.0377     Pep816
#> 1297          TRUE                 842.8438               842.6403     Pep817
#> 1298          TRUE                 917.5257               917.5190     Pep459
#> 1299          TRUE                 688.4210               687.9075     Pep818
#> 1300          TRUE                 473.2972               473.2956     Pep819
#> 1301          TRUE                 668.0516               667.7175     Pep820
#> 1302          TRUE                 658.3938               657.8881     Pep821
#> 1303          TRUE                 852.1440               852.1389     Pep822
#> 1304          TRUE                 659.3959               659.4067    Pep2803
#> 1305          TRUE                1036.6157              1036.0991     Pep824
#> 1306          TRUE                 701.8896               701.9010     Pep541
#> 1307          TRUE                 807.1160               807.1179     Pep825
#> 1308          TRUE                 559.3204               559.3225     Pep826
#> 1309          TRUE                 794.4447               794.4443     Pep827
#> 1310          TRUE                 619.3361               618.8460    Pep1825
#> 1311          TRUE                 799.4155               799.0836     Pep829
#> 1312          TRUE                 523.6341               523.3020     Pep830
#> 1313          TRUE                 843.4432               843.4370    Pep1828
#> 1314          TRUE                 563.0070               562.6760    Pep1829
#> 1315          TRUE                1061.5582              1061.5531     Pep833
#> 1316          TRUE                 558.8408               558.8354     Pep834
#> 1317          TRUE                 906.5140               906.5229     Pep835
#> 1318          TRUE                 685.9134               685.9048    Pep1833
#> 1319          TRUE                 712.3896               712.4019    Pep1834
#> 1320          TRUE                 687.0564               686.7200     Pep838
#> 1321          TRUE                1029.5142              1029.0154     Pep839
#> 1322          TRUE                 865.7716               865.4209     Pep840
#> 1323          TRUE                1134.1149              1134.1002     Pep841
#> 1324          TRUE                 872.4490               872.1863     Pep842
#> 1325          TRUE                 698.3752               698.3798     Pep843
#> 1326          TRUE                 674.0302               674.0179     Pep844
#> 1327          TRUE                 491.2747               491.2779     Pep845
#> 1328          TRUE                 599.6929               599.3564     Pep846
#> 1329          TRUE                 636.8668               636.8708     Pep847
#> 1330          TRUE                1288.2463              1287.7238     Pep848
#> 1331          TRUE                 983.5423               983.0406     Pep849
#> 1332          TRUE                 685.3795               685.3866     Pep850
#> 1333          TRUE                 981.2463               981.2507     Pep851
#> 1334          TRUE                 666.3525               666.0111     Pep852
#> 1335          TRUE                 715.9015               715.3915     Pep853
#> 1336          TRUE                1044.2502              1043.9128     Pep741
#> 1337          TRUE                 653.6892               653.6902     Pep854
#> 1338          TRUE                 635.0546               634.7083     Pep369
#> 1339          TRUE                 599.6790               599.6816     Pep855
#> 1340          TRUE                 545.6777               545.6812    Pep1854
#> 1341          TRUE                 566.8048               566.7986     Pep857
#> 1342          TRUE                 594.8683               594.8573     Pep858
#> 1343          TRUE                 670.9026               670.8915     Pep859
#> 1344          TRUE                 725.7393               725.7426     Pep860
#> 1345          TRUE                 668.4030               668.3982    Pep1857
#> 1346          TRUE                 803.9184               803.4089     Pep862
#> 1347          TRUE                 949.5145               949.5121     Pep863
#> 1348          TRUE                 578.3270               577.9911     Pep864
#> 1349          TRUE                 650.3565               650.0197     Pep865
#> 1350          TRUE                 626.7144               626.7227     Pep866
#> 1351          TRUE                 935.7303               935.7339     Pep867
#> 1352          TRUE                 815.4286               815.4179     Pep868
#> 1353          TRUE                 420.9314               420.9386     Pep869
#> 1354          TRUE                 401.2523               401.2600     Pep870
#> 1355          TRUE                 822.7741               822.4333    Pep1866
#> 1356          TRUE                 696.8579               696.3494     Pep872
#> 1357          TRUE                 818.7747               818.4481     Pep873
#> 1358          TRUE                 722.9022               722.9138    Pep1869
#> 1359          TRUE                 697.8776               697.8823     Pep874
#> 1360          TRUE                 764.4444               764.4413     Pep875
#> 1361          TRUE                 548.3190               548.3092     Pep876
#> 1362          TRUE                1103.5956              1103.5881     Pep341
#> 1363          TRUE                1037.5183              1037.5299     Pep877
#> 1364          TRUE                 878.4363               878.4409      Pep62
#> 1365          TRUE                 945.7742               945.5203     Pep878
#> 1366          TRUE                 488.3023               487.7931     Pep879
#> 1367          TRUE                 576.3395               575.9992     Pep880
#> 1368          TRUE                 859.1668               858.8182     Pep848
#> 1369          TRUE                 589.6695               589.3271     Pep881
#> 1370          TRUE                 503.5284               503.5262     Pep882
#> 1371          TRUE                 600.0949               599.8509     Pep883
#> 1372          TRUE                 552.8252               552.8173     Pep884
#> 1373          TRUE                 973.0469               973.0436     Pep885
#> 1374          TRUE                 661.3572               660.8602     Pep886
#> 1375          TRUE                 886.9932               886.4943     Pep887
#> 1376          TRUE                 571.8441               571.3450     Pep888
#> 1377          TRUE                 495.7654               495.2578     Pep889
#> 1378          TRUE                 853.1116               852.7934     Pep890
#> 1379          TRUE                 878.9520               878.6992     Pep891
#> 1380          TRUE                 703.3353               702.8232     Pep892
#> 1381          TRUE                 589.8210               589.8231    Pep1890
#> 1382          TRUE                 589.8210               589.8231    Pep1890
#> 1383          TRUE                 589.8210               589.8231    Pep1890
#> 1384          TRUE                 665.8777               665.6207     Pep895
#> 1385          TRUE                 835.0994               834.7664     Pep896
#> 1386          TRUE                 409.7410               409.7332     Pep897
#> 1387          TRUE                 571.3391               571.3307     Pep898
#> 1388          TRUE                 551.8124               551.3192     Pep899
#> 1389          TRUE                 851.4996               851.4956     Pep900
#> 1390          TRUE                1158.8892              1158.5533     Pep901
#> 1391          TRUE                 525.3067               524.7986     Pep902
#> 1392          TRUE                 894.0068               893.4896     Pep903
#> 1393          TRUE                 472.2898               471.9622     Pep904
#> 1394          TRUE                 487.9953               487.7529     Pep905
#> 1395          TRUE                 718.9232               718.4144     Pep906
#> 1396          TRUE                 577.3454               577.3443     Pep907
#> 1397          TRUE                 750.4615               749.9536    Pep1902
#> 1398          TRUE                 939.5042               939.4861     Pep909
#> 1399          TRUE                 883.4896               883.4890     Pep910
#> 1400          TRUE                 717.9457               717.4316     Pep911
#> 1401          TRUE                 626.3960               625.8882     Pep912
#> 1402          TRUE                 497.8181               497.3082     Pep913
#> 1403          TRUE                 657.3708               657.3584     Pep914
#> 1404          TRUE                1036.9266              1036.9164     Pep915
#> 1405          TRUE                 819.9404               819.9316    Pep1910
#> 1406          TRUE                 819.9404               819.9396    Pep1911
#> 1407          TRUE                1008.1938              1008.1963     Pep918
#> 1408          TRUE                 615.8703               615.3666    Pep1913
#> 1409          TRUE                 461.2762               461.2725     Pep920
#> 1410          TRUE                 683.4078               683.4110     Pep921
#> 1411          TRUE                 789.1718               789.1608     Pep922
#> 1412          TRUE                 838.1395               837.7889     Pep601
#> 1413          TRUE                1185.6329              1185.6541     Pep923
#> 1414          TRUE                 769.4028               769.0588     Pep924
#> 1415          TRUE                 899.8375               899.5033    Pep1326
#> 1416          TRUE                 544.7775               544.5262     Pep926
#> 1417          TRUE                 599.3848               599.3749     Pep927
#> 1418          TRUE                 514.9652               514.6339     Pep928
#> 1419          TRUE                 764.9624               764.9565     Pep929
#> 1420          TRUE                 543.3271               542.8280     Pep930
#> 1421          TRUE                 665.3769               665.3860     Pep931
#> 1422          TRUE                 589.3451               589.3439     Pep932
#> 1423          TRUE                 746.4070               746.4059    Pep1926
#> 1424          TRUE                 484.2372               483.9901     Pep934
#> 1425          TRUE                 851.7766               851.7751     Pep935
#> 1426          TRUE                 676.3732               676.3839    Pep1929
#> 1427          TRUE                 573.0073               573.0004     Pep937
#> 1428          TRUE                 488.2855               488.2778     Pep938
#> 1429          TRUE                 890.4800               890.4899     Pep939
#> 1430          TRUE                 535.6260               535.6241     Pep940
#> 1431          TRUE                 545.6269               545.2934     Pep941
#> 1432          TRUE                 994.1498               994.1443     Pep942
#> 1433          TRUE                 884.9651               884.7008     Pep943
#> 1434          TRUE                 544.3505               543.8428    Pep1937
#> 1435          TRUE                 606.3441               606.3329     Pep945
#> 1436          TRUE                 990.4556               989.9690     Pep946
#> 1437          TRUE                1155.5962              1155.2584     Pep947
#> 1438          TRUE                 632.8668               632.3551     Pep948
#> 1439          TRUE                 654.0378               653.7074     Pep949
#> 1440          TRUE                 495.3400               494.8300     Pep950
#> 1441          TRUE                 562.3240               562.3187     Pep951
#> 1442          TRUE                 762.0843               761.7524     Pep952
#> 1443          TRUE                 533.9191               533.5856     Pep953
#> 1444          TRUE                 544.3514               543.8428     Pep954
#> 1445          TRUE                 474.2715               473.7771     Pep955
#> 1446          TRUE                 679.7150               679.7140     Pep956
#> 1447          TRUE                 829.9350               829.4227     Pep957
#> 1448          TRUE                 650.1247               650.1276     Pep958
#> 1449          TRUE                 787.9360               787.9322     Pep959
#> 1450          TRUE                 422.5517               422.5581     Pep960
#> 1451          TRUE                 464.2815               464.2903     Pep961
#> 1452          TRUE                 507.6275               507.6351     Pep962
#> 1453          TRUE                 859.1685               858.8182     Pep848
#> 1454          TRUE                 470.9629               470.6207     Pep963
#> 1455          TRUE                 589.3409               588.8404     Pep964
#> 1456          TRUE                 621.9931               621.6705    Pep1957
#> 1457          TRUE                 906.4803               906.4885     Pep966
#> 1458          TRUE                 407.7619               407.7609     Pep967
#> 1459          TRUE                 557.8608               557.8657     Pep968
#> 1460          TRUE                 671.4436               671.4325     Pep969
#> 1461          TRUE                 807.1298               806.7949     Pep970
#> 1462          TRUE                 569.3190               568.8066     Pep971
#> 1463          TRUE                 968.1843               967.8637     Pep972
#> 1464          TRUE                 908.0267               908.0204     Pep973
#> 1465          TRUE                 847.0562               847.0580     Pep974
#> 1466          TRUE                 560.3114               560.3192     Pep975
#> 1467          TRUE                 441.7565               441.7488     Pep976
#> 1468          TRUE                 601.6987               601.6943     Pep977
#> 1469          TRUE                 643.8786               643.3797     Pep978
#> 1470          TRUE                 647.3663               646.8535     Pep979
#> 1471          TRUE                 665.7226               665.3871     Pep980
#> 1472          TRUE                1062.2418              1062.2347     Pep981
#> 1473          TRUE                 920.4817               919.9678     Pep982
#> 1474          TRUE                 675.7070               675.3778     Pep983
#> 1475          TRUE                 422.2471               422.2473     Pep984
#> 1476          TRUE                 422.2471               422.2473     Pep984
#> 1477          TRUE                 422.2471               422.2473     Pep984
#> 1478          TRUE                 500.9637               500.9560     Pep985
#> 1479          TRUE                 725.8723               725.3815     Pep986
#> 1480          TRUE                 491.7974               491.2976     Pep987
#> 1481          TRUE                 560.3177               560.3115     Pep988
#> 1482          TRUE                 927.9348               927.9200     Pep989
#> 1483          TRUE                 627.4172               627.4062     Pep990
#> 1484          TRUE                 557.8375               557.3412     Pep991
#> 1485          TRUE                 524.7870               524.2771     Pep992
#> 1486          TRUE                 839.1436               838.7991     Pep993
#> 1487          TRUE                1330.7529              1330.2343     Pep895
#> 1488          TRUE                 672.0406               671.7083     Pep994
#> 1489          TRUE                 696.9083               696.4082     Pep995
#> 1490          TRUE                1171.6010              1171.6112     Pep996
#> 1491          TRUE                 490.2613               490.2567    Pep1984
#> 1492          TRUE                 547.7944               547.3004     Pep998
#> 1493          TRUE                 740.4396               740.4252     Pep999
#> 1494          TRUE                 834.4089               833.9234    Pep1987
#> 1495          TRUE                 580.3142               579.8170    Pep1001
#> 1496          TRUE                 515.3317               514.8254    Pep1002
#> 1497          TRUE                 845.4547               845.4575    Pep1003
#> 1498          TRUE                 845.4547               845.4575    Pep1003
#> 1499          TRUE                1040.5796              1040.2274    Pep1004
#> 1500          TRUE                 509.2907               509.2956    Pep1993
#> 1501          TRUE                 689.7018               689.3679    Pep1006
#> 1502          TRUE                 822.1901               821.9366    Pep1994
#> 1503          TRUE                 850.4374               849.9227    Pep1008
#> 1504          TRUE                 736.0652               736.0612     Pep341
#> 1505          TRUE                 419.2184               418.8898    Pep1009
#> 1506          TRUE                 932.4867               931.9877    Pep1010
#> 1507          TRUE                1019.0651              1019.0673     Pep956
#> 1508          TRUE                 893.8280               893.4938    Pep1011
#> 1509          TRUE                 492.9606               492.9560    Pep1012
#> 1510          TRUE                 955.5145               955.5102    Pep1013
#> 1511          TRUE                 719.0647               718.7345    Pep1014
#> 1512          TRUE                 716.8853               716.3888    Pep1015
#> 1513          TRUE                 632.6896               632.6852    Pep1016
#> 1514          TRUE                 514.3290               513.8302    Pep1017
#> 1515          TRUE                 827.4336               827.0918    Pep1018
#> 1516          TRUE                 594.9784               594.9676    Pep1019
#> 1517          TRUE                 515.3226               515.3217    Pep1020
#> 1518          TRUE                 961.4958               961.0126    Pep1021
#> 1519          TRUE                 862.9837               862.9832    Pep2009
#> 1520          TRUE                 914.8453               914.8591    Pep1023
#> 1521          TRUE                 827.1679               826.9178    Pep1024
#> 1522          TRUE                 827.1679               827.1680    Pep1025
#> 1523          TRUE                 568.3198               568.3271    Pep1026
#> 1524          TRUE                 422.2845               421.7821    Pep2014
#> 1525          TRUE                 917.0023               916.4997    Pep1028
#> 1526          TRUE                 413.2747               413.2801    Pep1029
#> 1527          TRUE                1057.3127              1057.3110    Pep1030
#> 1528          TRUE                1007.5361              1007.1926    Pep1031
#> 1529          TRUE                 880.5238               880.0073    Pep1032
#> 1530          TRUE                 472.2936               471.7845    Pep1033
#> 1531          TRUE                 654.3380               654.3457    Pep1034
#> 1532          TRUE                 654.3380               654.3457    Pep1034
#> 1533          TRUE                 654.3380               654.3457    Pep1034
#> 1534          TRUE                 687.0420               687.0531    Pep1035
#> 1535          TRUE                 813.7649               813.4394    Pep1036
#> 1536          TRUE                 822.0088               821.9929    Pep1037
#> 1537          TRUE                 423.7465               423.7509    Pep1038
#> 1538          TRUE                 584.6648               584.6674    Pep1039
#> 1539          TRUE                 793.0467               792.8333    Pep1040
#> 1540          TRUE                1184.6315              1184.6451    Pep1041
#> 1541          TRUE                 631.3677               631.3559    Pep1042
#> 1542          TRUE                1144.5890              1144.5812    Pep1043
#> 1543          TRUE                 526.7884               526.2802    Pep1044
#> 1544          TRUE                 483.7879               483.2823    Pep1045
#> 1545          TRUE                 539.9905               539.9847    Pep1046
#> 1546          TRUE                 727.9100               727.9094    Pep1047
#> 1547          TRUE                 646.3596               646.3524    Pep2034
#> 1548          TRUE                1141.3488              1141.3406    Pep1048
#> 1549          TRUE                 556.3674               556.3566    Pep2036
#> 1550          TRUE                 820.9517               820.4586    Pep1050
#> 1551          TRUE                 464.9227               464.5808    Pep1051
#> 1552          TRUE                 464.9227               464.5841    Pep1052
#> 1553          TRUE                 461.9487               461.6124    Pep1053
#> 1554          TRUE                 411.7465               411.7418    Pep1054
#> 1555          TRUE                 411.7465               411.7418    Pep1054
#> 1556          TRUE                 411.7465               411.7418    Pep1054
#> 1557          TRUE                 411.7465               411.7418    Pep1054
#> 1558          TRUE                 411.7465               411.7418    Pep1055
#> 1559          TRUE                 776.6842               776.6693     Pep791
#> 1560          TRUE                 927.9207               927.4313    Pep1056
#> 1561          TRUE                 875.7828               875.4416    Pep1057
#> 1562          TRUE                 764.4110               764.1479    Pep1058
#> 1563          TRUE                 482.2647               482.2692    Pep1059
#> 1564          TRUE                 892.9879               892.9988    Pep1060
#> 1565          TRUE                 591.6706               591.3478    Pep2052
#> 1566          TRUE                 801.4219               801.4177    Pep1062
#> 1567          TRUE                 801.4219               801.4089    Pep1063
#> 1568          TRUE                 597.3690               597.0280    Pep1064
#> 1569          TRUE                 710.3926               709.8823    Pep1065
#> 1570          TRUE                 767.1941               766.9401    Pep1066
#> 1571          TRUE                 844.5116               844.0245    Pep1067
#> 1572          TRUE                 753.4405               752.9502    Pep2058
#> 1573          TRUE                 844.9829               844.4732    Pep1069
#> 1574          TRUE                 946.0807               946.0948    Pep1070
#> 1575          TRUE                 720.7129               720.7053    Pep1071
#> 1576          TRUE                 762.9145               762.3999    Pep1072
#> 1577          TRUE                 707.6240               707.3640    Pep1073
#> 1578          TRUE                 475.2905               474.7856    Pep1074
#> 1579          TRUE                 452.7595               452.7516    Pep1075
#> 1580          TRUE                 778.3892               778.3831    Pep1076
#> 1581          TRUE                 736.9229               736.9272    Pep1077
#> 1582          TRUE                 848.7784               848.7870    Pep1078
#> 1583          TRUE                 697.4262               697.4180    Pep1079
#> 1584          TRUE                 644.3883               643.8773    Pep1080
#> 1585          TRUE                 713.4467               712.9335    Pep1081
#> 1586          TRUE                 501.3047               501.0522    Pep1082
#> 1587          TRUE                 987.5529               987.2194     Pep685
#> 1588          TRUE                 862.4432               861.9332     Pep323
#> 1589          TRUE                1168.1445              1167.6302    Pep1083
#> 1590          TRUE                 896.9872               896.9945    Pep1084
#> 1591          TRUE                 745.7437               745.7375    Pep1085
#> 1592          TRUE                 745.7437               745.7357    Pep1086
#> 1593          TRUE                1035.2437              1035.2234     Pep791
#> 1594          TRUE                 572.3613               572.3687    Pep1087
#> 1595          TRUE                 862.4813               862.4900    Pep1088
#> 1596          TRUE                 604.3459               603.8425    Pep1089
#> 1597          TRUE                 588.3738               587.8696     Pep204
#> 1598          TRUE                 713.0763               713.0698    Pep1090
#> 1599          TRUE                1078.6012              1078.6221    Pep1091
#> 1600          TRUE                 923.8367               923.8224    Pep1092
#> 1601          TRUE                 558.8132               558.8161    Pep1093
#> 1602          TRUE                 838.4600               838.1100    Pep2085
#> 1603          TRUE                 747.9347               747.4254    Pep1095
#> 1604          TRUE                1179.6248              1179.6243    Pep1096
#> 1605          TRUE                 660.8851               660.8728    Pep1097
#> 1606          TRUE                 555.3423               554.8511    Pep1098
#> 1607          TRUE                 693.8619               693.8542    Pep1099
#> 1608          TRUE                 452.2777               451.9406    Pep2090
#> 1609          TRUE                1252.1488              1252.1663    Pep1101
#> 1610          TRUE                 519.8290               519.3289     Pep799
#> 1611          TRUE                 599.3738               599.3680    Pep1102
#> 1612          TRUE                 606.3837               605.8851    Pep1103
#> 1613          TRUE                 473.9429               473.6003    Pep2095
#> 1614          TRUE                 617.3800               617.3806    Pep1105
#> 1615          TRUE                 520.3192               520.3133    Pep1106
#> 1616          TRUE                 744.0676               744.0565    Pep1107
#> 1617          TRUE                 695.0591               694.7167    Pep1108
#> 1618          TRUE                 495.0024               494.6595    Pep1109
#> 1619          TRUE                 559.8196               559.3275    Pep1110
#> 1620          TRUE                 857.7933               857.8100    Pep1111
#> 1621          TRUE                 803.1012               802.7644    Pep2103
#> 1622          TRUE                 596.3342               596.0076    Pep1113
#> 1623          TRUE                 621.8729               621.8731    Pep2105
#> 1624          TRUE                1004.0566              1003.5376    Pep1115
#> 1625          TRUE                1303.2135              1302.7112    Pep3092
#> 1626          TRUE                 576.8013               576.8060    Pep1117
#> 1627          TRUE                 542.7820               542.7820    Pep1118
#> 1628          TRUE                 460.2848               460.2828     Pep770
#> 1629          TRUE                 760.4306               760.4255    Pep1119
#> 1630          TRUE                 530.8010               530.3082    Pep1120
#> 1631          TRUE                 897.1566               897.1596    Pep1121
#> 1632          TRUE                 736.7424               736.7334    Pep1122
#> 1633          TRUE                 458.7927               458.2834    Pep1123
#> 1634          TRUE                 458.7927               458.2834    Pep1123
#> 1635          TRUE                 524.9626               524.9716    Pep1124
#> 1636          TRUE                 878.9492               878.4529    Pep1125
#> 1637          TRUE                 539.5928               539.5954    Pep1126
#> 1638          TRUE                 872.5061               872.1606    Pep1127
#> 1639          TRUE                 487.2960               486.7905    Pep1128
#> 1640          TRUE                 655.0431               654.7092    Pep2120
#> 1641          TRUE                 689.3734               689.3725    Pep2121
#> 1642          TRUE                1132.1173              1132.0951    Pep1131
#> 1643          TRUE                 860.4847               859.9778      Pep64
#> 1644          TRUE                 801.4363               801.0993    Pep1132
#> 1645          TRUE                 781.9515               781.9361    Pep1133
#> 1646          TRUE                 937.5348               937.2009    Pep1134
#> 1647          TRUE                 591.3454               590.8379    Pep1135
#> 1648          TRUE                 784.7903               784.7825    Pep1136
#> 1649          TRUE                 500.6469               500.6471    Pep1137
#> 1650          TRUE                 581.3559               581.3518    Pep1138
#> 1651          TRUE                 501.2641               500.7715    Pep1139
#> 1652          TRUE                 525.3268               525.3193    Pep1140
#> 1653          TRUE                 692.4081               692.0763    Pep1141
#> 1654          TRUE                 922.5443               922.5486    Pep1142
#> 1655          TRUE                 750.4062               750.4019    Pep1143
#> 1656          TRUE                 433.5626               433.5703    Pep1144
#> 1657          TRUE                 736.0938               735.7624    Pep1145
#> 1658          TRUE                 846.4738               845.9691    Pep1146
#> 1659          TRUE                 711.3419               711.3490    Pep1147
#> 1660          TRUE                 804.7805               804.4327    Pep1148
#> 1661          TRUE                 654.7107               654.3803    Pep3121
#> 1662          TRUE                1030.0822              1030.0627    Pep1149
#> 1663          TRUE                 795.0973               794.7693    Pep1150
#> 1664          TRUE                 747.0685               746.7487    Pep1151
#> 1665          TRUE                 543.8333               543.3236    Pep1152
#> 1666          TRUE                 547.6433               547.3044    Pep1153
#> 1667          TRUE                 530.3119               530.3083    Pep1154
#> 1668          TRUE                 902.8264               902.4922    Pep2145
#> 1669          TRUE                 861.4800               861.4677    Pep2146
#> 1670          TRUE                 618.8438               618.8328    Pep1156
#> 1671          TRUE                 400.2790               400.2727    Pep1157
#> 1672          TRUE                 446.6226               446.6295    Pep1158
#> 1673          TRUE                1056.0973              1056.0820    Pep1159
#> 1674          TRUE                 600.3332               600.3305    Pep1160
#> 1675          TRUE                 723.1080               723.1027    Pep1161
#> 1676          TRUE                 783.7792               783.7803    Pep1162
#> 1677          TRUE                 814.6942               814.4346    Pep1163
#> 1678          TRUE                 653.7100               653.3860    Pep1164
#> 1679          TRUE                 486.7743               486.2803    Pep1165
#> 1680          TRUE                 691.4136               691.4091    Pep1166
#> 1681          TRUE                 941.5735               941.0676     Pep652
#> 1682          TRUE                 757.8986               757.4077    Pep1167
#> 1683          TRUE                1220.6610              1220.1450    Pep1168
#> 1684          TRUE                 600.9703               600.6456    Pep1169
#> 1685          TRUE                 600.9703               600.6272    Pep1170
#> 1686          TRUE                1173.3700              1173.3923    Pep1171
#> 1687          TRUE                1127.3434              1127.3367    Pep1172
#> 1688          TRUE                 685.8900               685.8988    Pep1173
#> 1689          TRUE                 721.7168               721.3723    Pep1174
#> 1690          TRUE                 836.9319               836.6886    Pep1175
#> 1691          TRUE                 449.2684               448.9330    Pep1176
#> 1692          TRUE                 835.7954               835.7849    Pep1177
#> 1693          TRUE                 649.7186               649.3813    Pep1178
#> 1694          TRUE                1049.5679              1049.5632     Pep611
#> 1695          TRUE                 777.4120               777.0788    Pep1179
#> 1696          TRUE                 837.9847               837.9716    Pep2172
#> 1697          TRUE                1237.1160              1236.6223    Pep1181
#> 1698          TRUE                 604.6559               604.6614     Pep966
#> 1699          TRUE                 916.7408               916.7455    Pep1182
#> 1700          TRUE                 613.3596               613.3659    Pep1183
#> 1701          TRUE                 697.3574               697.1049    Pep1184
#> 1702          TRUE                 678.0596               678.0686    Pep2178
#> 1703          TRUE                 871.4948               870.9950    Pep1186
#> 1704          TRUE                 539.3173               539.3138    Pep2180
#> 1705          TRUE                 835.2409               835.2393    Pep1188
#> 1706          TRUE                 746.6405               746.4018    Pep2182
#> 1707          TRUE                 755.9377               755.4327    Pep1190
#> 1708          TRUE                 960.0287               959.5151    Pep1191
#> 1709          TRUE                 884.9951               884.5074    Pep3163
#> 1710          TRUE                 632.8625               632.3677    Pep1193
#> 1711          TRUE                 749.7605               749.4132    Pep1194
#> 1712          TRUE                 778.4485               777.9323    Pep1195
#> 1713          TRUE                 790.0891               790.0991    Pep1041
#> 1714          TRUE                 719.9117               719.8980    Pep1196
#> 1715          TRUE                 629.8992               629.3855    Pep1197
#> 1716          TRUE                 599.3108               599.3022    Pep1198
#> 1717          TRUE                 618.3389               618.3282    Pep1199
#> 1718          TRUE                 803.7253               803.4045    Pep1200
#> 1719          TRUE                 761.7523               761.7524     Pep952
#> 1720          TRUE                 883.8047               883.8014    Pep1201
#> 1721          TRUE                 892.4999               892.1639    Pep1202
#> 1722          TRUE                 837.5079               837.4941    Pep1203
#> 1723          TRUE                 564.3211               564.3232    Pep1204
#> 1724          TRUE                 749.4386               749.4473    Pep1205
#> 1725          TRUE                 402.2068               401.7119    Pep1206
#> 1726          TRUE                 800.9516               800.9551    Pep1207
#> 1727          TRUE                 731.0902               730.7414    Pep2202
#> 1728          TRUE                 660.8998               660.8986    Pep2203
#> 1729          TRUE                 756.8983               756.9052    Pep1209
#> 1730          TRUE                 493.7790               493.5237    Pep2205
#> 1731          TRUE                 808.5064               808.0050    Pep1211
#> 1732          TRUE                 733.7588               733.4318    Pep1212
#> 1733          TRUE                 597.3208               596.8168    Pep1213
#> 1734          TRUE                1337.2325              1336.7465    Pep2209
#> 1735          TRUE                 683.3792               683.3806    Pep1215
#> 1736          TRUE                 819.9622               819.9774    Pep1216
#> 1737          TRUE                 795.1204               794.7910    Pep1217
#> 1738          TRUE                 762.4057               762.4089    Pep1218
#> 1739          TRUE                 645.8660               645.8762    Pep1219
#> 1740          TRUE                 401.9794               401.7263    Pep2214
#> 1741          TRUE                 665.7104               665.3781    Pep1221
#> 1742          TRUE                 648.0303               648.0217    Pep1222
#> 1743          TRUE                 408.7508               408.7581    Pep1223
#> 1744          TRUE                 672.3725               672.1152    Pep1224
#> 1745          TRUE                1240.6475              1240.6503    Pep1225
#> 1746          TRUE                 403.7509               403.2558    Pep2219
#> 1747          TRUE                 702.0353               701.7009    Pep1227
#> 1748          TRUE                 744.4324               744.0900    Pep1228
#> 1749          TRUE                 910.4811               910.4834    Pep1229
#> 1750          TRUE                 781.9810               781.9850    Pep1230
#> 1751          TRUE                 728.9470               728.4451    Pep1231
#> 1752          TRUE                 643.8960               643.3956    Pep2224
#> 1753          TRUE                1351.7437              1351.2157    Pep1233
#> 1754          TRUE                1351.7437              1351.2157    Pep1233
#> 1755          TRUE                 673.0460               673.0445    Pep1234
#> 1756          TRUE                 436.5972               436.2557    Pep1235
#> 1757          TRUE                 550.9639               550.6264    Pep1236
#> 1758          TRUE                 581.8437               581.3531    Pep1237
#> 1759          TRUE                 766.7590               766.4169    Pep2230
#> 1760          TRUE                1245.6494              1245.6334    Pep1238
#> 1761          TRUE                 902.4611               901.9482    Pep1239
#> 1762          TRUE                 733.4224               733.4160    Pep1240
#> 1763          TRUE                 467.2455               466.7458    Pep1241
#> 1764          TRUE                 957.8466               957.5009    Pep1242
#> 1765          TRUE                 775.4139               775.0649    Pep1243
#> 1766          TRUE                 609.3466               608.8484    Pep1244
#> 1767          TRUE                1105.8141              1105.5840    Pep1245
#> 1768          TRUE                 573.3361               573.0051    Pep1246
#> 1769          TRUE                 891.9519               891.9623    Pep1247
#> 1770          TRUE                 947.2646               947.2657    Pep1248
#> 1771          TRUE                 717.3832               717.3840    Pep1249
#> 1772          TRUE                 521.3422               521.3327    Pep1686
#> 1773          TRUE                 742.9115               742.9041    Pep1251
#> 1774          TRUE                 781.4484               780.9541    Pep1252
#> 1775          TRUE                 751.7551               751.7560    Pep1253
#> 1776          TRUE                 519.8286               519.3289     Pep799
#> 1777          TRUE                 665.8751               665.8755    Pep1254
#> 1778          TRUE                 569.9959               569.9849    Pep2248
#> 1779          TRUE                 792.0837               792.0961    Pep1256
#> 1780          TRUE                 985.5528               985.5690    Pep1257
#> 1781          TRUE                 631.8777               631.3731    Pep1948
#> 1782          TRUE                 669.3677               668.8779    Pep1259
#> 1783          TRUE                 612.6048               612.3494    Pep1260
#> 1784          TRUE                 549.8170               549.8190    Pep2253
#> 1785          TRUE                1108.6277              1108.1355    Pep1262
#> 1786          TRUE                 813.7806               813.7743    Pep1263
#> 1787          TRUE                 652.7106               652.3685    Pep1264
#> 1788          TRUE                 837.7642               837.4454    Pep1265
#> 1789          TRUE                 489.3157               488.8062     Pep463
#> 1790          TRUE                 843.1274               843.1354    Pep1266
#> 1791          TRUE                 911.5098               911.1588    Pep1267
#> 1792          TRUE                 437.2723               436.7748    Pep1268
#> 1793          TRUE                1052.5837              1052.5884    Pep1269
#> 1794          TRUE                 400.8885               400.5500    Pep1270
#> 1795          TRUE                 825.0800               825.0934    Pep1271
#> 1796          TRUE                 593.3455               592.8466    Pep2263
#> 1797          TRUE                 826.4506               826.4368    Pep1273
#> 1798          TRUE                 598.0002               597.9919    Pep1274
#> 1799          TRUE                 644.9938               644.9940    Pep1275
#> 1800          TRUE                 441.2603               440.9251    Pep1276
#> 1801          TRUE                1122.9105              1122.5795    Pep1277
#> 1802          TRUE                 974.4844               973.9919    Pep2269
#> 1803          TRUE                 525.8287               525.3270    Pep1279
#> 1804          TRUE                 532.8010               532.8016    Pep1280
#> 1805          TRUE                 456.2577               455.7645    Pep1281
#> 1806          TRUE                 504.9477               504.6158    Pep1282
#> 1807          TRUE                 708.0461               708.0341    Pep3255
#> 1808          TRUE                 894.4911               893.9833    Pep1284
#> 1809          TRUE                1322.6849              1322.6937    Pep1285
#> 1810          TRUE                 490.6274               490.2913    Pep1286
#> 1811          TRUE                 549.9655               549.9607    Pep1287
#> 1812          TRUE                 543.3362               543.3306    Pep1288
#> 1813          TRUE                1105.1410              1104.6217    Pep1289
#> 1814          TRUE                 712.3726               712.3759    Pep1290
#> 1815          TRUE                 716.3848               715.8823    Pep1291
#> 1816          TRUE                 716.3848               715.8918    Pep1292
#> 1817          TRUE                 780.9520               780.9577    Pep1293
#> 1818          TRUE                 904.4446               904.1229    Pep2285
#> 1819          TRUE                 706.3759               706.3677    Pep1295
#> 1820          TRUE                 596.8597               596.3641    Pep1296
#> 1821          TRUE                 467.7838               467.2762    Pep2287
#> 1822          TRUE                 638.3653               637.8651    Pep1298
#> 1823          TRUE                 856.9755               856.4781    Pep1299
#> 1824          TRUE                 625.3533               625.0156    Pep1300
#> 1825          TRUE                 617.3538               617.0112    Pep1301
#> 1826          TRUE                 490.2617               489.7670    Pep1302
#> 1827          TRUE                 650.8756               650.3763    Pep1303
#> 1828          TRUE                 735.4569               735.4512    Pep1304
#> 1829          TRUE                 873.4700               873.4720    Pep1305
#> 1830          TRUE                 934.1593               934.1765    Pep2295
#> 1831          TRUE                 666.0261               666.0385    Pep1307
#> 1832          TRUE                 623.0058               623.0161    Pep1308
#> 1833          TRUE                 700.4407               699.9306    Pep1309
#> 1834          TRUE                 760.4117               760.4180    Pep1310
#> 1835          TRUE                 483.7700               483.7664    Pep1311
#> 1836          TRUE                 558.6747               558.6727    Pep3282
#> 1837          TRUE                 454.7837               454.7805    Pep1313
#> 1838          TRUE                 454.7837               454.7805    Pep1313
#> 1839          TRUE                 755.0668               755.0637    Pep1314
#> 1840          TRUE                1085.9246              1085.9052    Pep1315
#> 1841          TRUE                 587.8450               587.3462    Pep1316
#> 1842          TRUE                 440.9418               440.9348    Pep1317
#> 1843          TRUE                 819.7728               819.4262    Pep1318
#> 1844          TRUE                 460.7500               460.7531    Pep1319
#> 1845          TRUE                 618.9610               618.6343    Pep1320
#> 1846          TRUE                 637.3644               637.3547     Pep122
#> 1847          TRUE                 403.7445               403.2432    Pep1321
#> 1848          TRUE                 507.7740               507.2780    Pep1322
#> 1849          TRUE                 715.9218               715.4243    Pep1323
#> 1850          TRUE                 892.2181               892.2014    Pep1324
#> 1851          TRUE                 626.3960               625.8882     Pep912
#> 1852          TRUE                 569.2960               569.2993    Pep1325
#> 1853          TRUE                 675.1302               674.8793    Pep1326
#> 1854          TRUE                 752.8985               752.3994    Pep1327
#> 1855          TRUE                 914.8453               914.8591    Pep1023
#> 1856          TRUE                 786.7503               786.4225    Pep1328
#> 1857          TRUE                 792.0972               792.0891    Pep2320
#> 1858          TRUE                 712.3987               712.0586    Pep1330
#> 1859          TRUE                 958.0219               958.0214    Pep2322
#> 1860          TRUE                 483.6514               483.3122    Pep1332
#> 1861          TRUE                 904.8223               904.4744    Pep2324
#> 1862          TRUE                 832.9437               832.9378    Pep1334
#> 1863          TRUE                 706.7134               706.7053    Pep1335
#> 1864          TRUE                 615.3584               614.8666    Pep1336
#> 1865          TRUE                 615.3584               614.8666    Pep1336
#> 1866          TRUE                 960.5419               960.5590    Pep1337
#> 1867          TRUE                 986.8414               986.8307    Pep1338
#> 1868          TRUE                 775.4915               774.9772    Pep1339
#> 1869          TRUE                 613.3707               613.3781    Pep1340
#> 1870          TRUE                 857.9596               857.4658     Pep539
#> 1871          TRUE                 662.3644               661.8694    Pep1341
#> 1872          TRUE                 770.9149               770.9075    Pep1342
#> 1873          TRUE                 859.0073               858.9970     Pep937
#> 1874          TRUE                 580.2941               580.2964    Pep2335
#> 1875          TRUE                 910.9722               910.4778    Pep1344
#> 1876          TRUE                 634.3325               634.3251    Pep1345
#> 1877          TRUE                 652.0469               652.0349    Pep2338
#> 1878          TRUE                 537.3171               537.3068    Pep1347
#> 1879          TRUE                 905.8558               905.8437    Pep2339
#> 1880          TRUE                 600.2924               600.3028    Pep1349
#> 1881          TRUE                 463.6014               463.2630    Pep1350
#> 1882          TRUE                 482.2682               482.2665    Pep1351
#> 1883          TRUE                 591.9840               591.6602     Pep629
#> 1884          TRUE                 795.1246               794.7910    Pep1217
#> 1885          TRUE                 801.4587               800.9495    Pep1352
#> 1886          TRUE                1085.5658              1085.0465    Pep1353
#> 1887          TRUE                 680.0543               679.7261    Pep1354
#> 1888          TRUE                 854.4596               854.4625    Pep1355
#> 1889          TRUE                 741.4754               740.9697    Pep1356
#> 1890          TRUE                 610.8444               610.3384     Pep368
#> 1891          TRUE                 641.3593               641.3705    Pep1357
#> 1892          TRUE                 642.7233               642.3863    Pep2351
#> 1893          TRUE                 897.0036               896.5005    Pep1359
#> 1894          TRUE                 476.7759               476.7754    Pep1360
#> 1895          TRUE                 788.1054               788.1078    Pep1361
#> 1896          TRUE                 630.8366               630.3282    Pep1362
#> 1897          TRUE                 469.7949               469.2845    Pep1363
#> 1898          TRUE                 697.3993               697.3936    Pep2356
#> 1899          TRUE                 418.7501               418.2429    Pep2357
#> 1900          TRUE                 599.3698               599.3680    Pep1102
#> 1901          TRUE                 676.3596               676.3605    Pep1366
#> 1902          TRUE                 771.4556               771.4618    Pep1367
#> 1903          TRUE                 610.8607               610.8522    Pep1368
#> 1904          TRUE                 693.1262               693.1225    Pep3345
#> 1905          TRUE                 589.6482               589.6541    Pep1370
#> 1906          TRUE                 438.2774               438.2732    Pep1371
#> 1907          TRUE                 684.0309               683.6846    Pep1372
#> 1908          TRUE                 495.7906               495.2816    Pep1373
#> 1909          TRUE                1007.5357              1007.5474    Pep1374
#> 1910          TRUE                 621.3751               621.3699    Pep1375
#> 1911          TRUE                 937.5260               937.5291    Pep1376
#> 1912          TRUE                 671.3578               671.0359    Pep1377
#> 1913          TRUE                 690.8596               690.8619     Pep749
#> 1914          TRUE                 473.5969               473.2699    Pep1378
#> 1915          TRUE                 502.3373               501.8266    Pep3354
#> 1916          TRUE                 961.1896               961.1991    Pep1380
#> 1917          TRUE                1174.5543              1174.5581    Pep1381
#> 1918          TRUE                 992.5547               992.5380    Pep1382
#> 1919          TRUE                 594.0112               594.0140    Pep1383
#> 1920          TRUE                 590.3322               589.8231    Pep1384
#> 1921          TRUE                 786.9391               786.4432    Pep1385
#> 1922          TRUE                 729.4012               729.3946    Pep1386
#> 1923          TRUE                 469.2578               468.9247    Pep1387
#> 1924          TRUE                 637.3571               636.8566    Pep2381
#> 1925          TRUE                 916.4832               916.4829    Pep1389
#> 1926          TRUE                1044.5459              1044.2142    Pep1390
#> 1927          TRUE                 990.5098               990.5208    Pep1391
#> 1928          TRUE                1156.6067              1156.2828    Pep1392
#> 1929          TRUE                 404.2526               404.2454    Pep1393
#> 1930          TRUE                 564.0164               563.6871    Pep1394
#> 1931          TRUE                 835.4277               835.0964    Pep1395
#> 1932          TRUE                 728.1152               727.7792    Pep1396
#> 1933          TRUE                 444.2643               444.2691    Pep1397
#> 1934          TRUE                 630.3839               630.3864    Pep2391
#> 1935          TRUE                 825.4468               825.4509    Pep3374
#> 1936          TRUE                 831.7037               831.4412    Pep1400
#> 1937          TRUE                 649.6331               649.3911    Pep1401
#> 1938          TRUE                 909.8381               909.8260    Pep1402
#> 1939          TRUE                1001.5745              1001.5871    Pep1403
#> 1940          TRUE                 841.4619               841.1172    Pep1404
#> 1941          TRUE                1033.5685              1033.5790    Pep1405
#> 1942          TRUE                 688.0716               688.0721    Pep2397
#> 1943          TRUE                 609.3915               609.0509    Pep1407
#> 1944          TRUE                 618.8712               618.3646    Pep1408
#> 1945          TRUE                 675.3636               674.8702    Pep1409
#> 1946          TRUE                 585.8487               585.8408     Pep484
#> 1947          TRUE                 554.0167               554.0154    Pep2401
#> 1948          TRUE                 462.2454               461.7350    Pep2402
#> 1949          TRUE                 468.6050               468.6088    Pep1412
#> 1950          TRUE                 509.7993               509.7968    Pep1413
#> 1951          TRUE                 912.1510               911.8192    Pep1414
#> 1952          TRUE                 738.9360               738.9233    Pep1415
#> 1953          TRUE                 594.7187               594.3782    Pep1416
#> 1954          TRUE                 447.2621               446.7662    Pep1417
#> 1955          TRUE                 893.0121               892.9996    Pep1418
#> 1956          TRUE                 760.4154               760.4117    Pep1419
#> 1957          TRUE                 674.4069               673.9051    Pep1420
#> 1958          TRUE                 596.6624               596.3246    Pep1284
#> 1959          TRUE                 559.6449               559.6483    Pep1421
#> 1960          TRUE                 879.9604               879.9603    Pep1422
#> 1961          TRUE                 496.7767               496.7822    Pep1423
#> 1962          TRUE                 508.8215               508.3278    Pep1424
#> 1963          TRUE                 426.2454               426.2479    Pep1425
#> 1964          TRUE                 601.3458               601.3401    Pep1426
#> 1965          TRUE                 599.3814               599.3749     Pep927
#> 1966          TRUE                 625.3540               625.0073    Pep1427
#> 1967          TRUE                 967.8647               967.8586    Pep1428
#> 1968          TRUE                 514.2474               514.2507    Pep1429
#> 1969          TRUE                 447.2562               446.7480    Pep1430
#> 1970          TRUE                 595.3030               595.3073    Pep1431
#> 1971          TRUE                 967.2226               966.8745     Pep513
#> 1972          TRUE                 804.4539               804.4525    Pep1432
#> 1973          TRUE                 770.7521               770.4060    Pep1433
#> 1974          TRUE                 575.3205               574.8122    Pep1434
#> 1975          TRUE                 750.9823               750.4803    Pep1435
#> 1976          TRUE                 584.6450               584.6348    Pep1436
#> 1977          TRUE                 624.3663               623.8669    Pep1437
#> 1978          TRUE                 919.9724               919.4851    Pep1438
#> 1979          TRUE                 539.3178               538.8073    Pep1439
#> 1980          TRUE                 539.3178               539.3231    Pep1440
#> 1981          TRUE                 812.4535               812.4470    Pep1441
#> 1982          TRUE                 559.3253               559.3212    Pep1442
#> 1983          TRUE                 467.0142               467.0062    Pep1443
#> 1984          TRUE                 467.0142               466.7654    Pep1444
#> 1985          TRUE                 610.8337               610.8228    Pep1445
#> 1986          TRUE                 948.2637               948.2593    Pep1446
#> 1987          TRUE                 424.7650               424.2610    Pep1447
#> 1988          TRUE                 452.9488               452.6064    Pep1448
#> 1989          TRUE                 892.4719               892.1404    Pep1449
#> 1990          TRUE                 490.2770               489.7670    Pep1302
#> 1991          TRUE                 760.4328               759.9286    Pep1450
#> 1992          TRUE                1013.4899              1012.9929    Pep1451
#> 1993          TRUE                1162.6199              1162.6414    Pep1452
#> 1994          TRUE                 958.0255               958.0384    Pep1453
#> 1995          TRUE                 859.1668               858.8182     Pep848
#> 1996          TRUE                 590.3367               589.8413    Pep1454
#> 1997          TRUE                 489.2871               489.2800    Pep1455
#> 1998          TRUE                 512.2896               512.2939    Pep1456
#> 1999          TRUE                1112.1028              1111.5951    Pep2448
#> 2000          TRUE                1112.1028              1111.6038    Pep2449
#> 2001          TRUE                 697.4304               697.4180    Pep1079
#> 2002          TRUE                 603.6756               603.6807    Pep1459
#> 2003          TRUE                 588.8281               588.3358    Pep2452
#> 2004          TRUE                 413.9626               413.9614    Pep1461
#> 2005          TRUE                 977.5276               977.5233    Pep1462
#> 2006          TRUE                 593.3246               592.8248    Pep2455
#> 2007          TRUE                 587.6646               587.6576     Pep283
#> 2008          TRUE                 612.3314               611.9992    Pep1464
#> 2009          TRUE                 598.3376               597.9929    Pep1465
#> 2010          TRUE                 828.4345               828.1152    Pep1466
#> 2011          TRUE                1049.9211              1049.9396    Pep1467
#> 2012          TRUE                 873.0314               873.0309    Pep2460
#> 2013          TRUE                 555.9905               555.9909    Pep1469
#> 2014          TRUE                 623.8739               623.3624    Pep1470
#> 2015          TRUE                 623.8739               623.3624    Pep1470
#> 2016          TRUE                 623.8739               623.3624    Pep1470
#> 2017          TRUE                 545.3014               545.3042    Pep1471
#> 2018          TRUE                 769.9159               769.4171    Pep3453
#> 2019          TRUE                1059.0231              1058.5156    Pep1473
#> 2020          TRUE                 406.5843               406.5823    Pep2464
#> 2021          TRUE                 474.7654               474.2552    Pep1475
#> 2022          TRUE                 538.3055               538.0454    Pep1476
#> 2023          TRUE                 618.8432               618.8328    Pep1477
#> 2024          TRUE                1044.5314              1044.5269    Pep1478
#> 2025          TRUE                1022.5921              1022.2554    Pep1479
#> 2026          TRUE                 976.0488               975.5384    Pep1480
#> 2027          TRUE                 813.7810               813.4590    Pep1481
#> 2028          TRUE                 794.2436               794.2318    Pep1382
#> 2029          TRUE                 546.3247               545.8276    Pep1482
#> 2030          TRUE                 765.7532               765.4094    Pep1483
#> 2031          TRUE                 645.4020               644.8891     Pep258
#> 2032          TRUE                 737.4438               737.4384    Pep1484
#> 2033          TRUE                 737.4438               737.4543    Pep1485
#> 2034          TRUE                 573.6596               573.6489    Pep1486
#> 2035          TRUE                 762.4059               762.4169    Pep1487
#> 2036          TRUE                 686.6791               686.6765    Pep1488
#> 2037          TRUE                 999.2599               999.0080    Pep1489
#> 2038          TRUE                 803.5212               803.5055    Pep1490
#> 2039          TRUE                 419.2456               418.9956    Pep1491
#> 2040          TRUE                 719.4450               719.4417    Pep2483
#> 2041          TRUE                 617.3572               617.0145    Pep1493
#> 2042          TRUE                 476.7802               476.2778    Pep1494
#> 2043          TRUE                1050.6113              1050.5999    Pep1495
#> 2044          TRUE                 578.0053               577.6770    Pep2487
#> 2045          TRUE                 722.3771               721.8674    Pep1497
#> 2046          TRUE                 635.4178               634.9173    Pep1498
#> 2047          TRUE                 572.3439               572.3515    Pep1499
#> 2048          TRUE                 759.1631               758.9200    Pep1500
#> 2049          TRUE                1065.0397              1064.7975    Pep1501
#> 2050          TRUE                 643.8998               643.3886    Pep2492
#> 2051          TRUE                 683.8955               683.6530    Pep1503
#> 2052          TRUE                1039.9208              1039.9335    Pep1504
#> 2053          TRUE                 735.6691               735.6653    Pep1505
#> 2054          TRUE                 844.7774               844.7625    Pep1506
#> 2055          TRUE                 823.9506               823.9467    Pep1507
#> 2056          TRUE                 708.0633               708.0503    Pep1508
#> 2057          TRUE                 429.2735               428.9359    Pep1509
#> 2058          TRUE                 881.9854               881.4972    Pep1510
#> 2059          TRUE                 525.3212               525.3193    Pep1511
#> 2060          TRUE                1015.5395              1015.5508     Pep732
#> 2061          TRUE                 754.0898               754.0756    Pep1513
#> 2062          TRUE                 634.8033               634.7990    Pep1514
#> 2063          TRUE                 555.3679               555.3782    Pep1515
#> 2064          TRUE                 517.3228               516.8305    Pep1516
#> 2065          TRUE                 570.3222               569.8094    Pep1517
#> 2066          TRUE                 568.8422               568.3328    Pep1518
#> 2067          TRUE                 624.3646               623.8620      Pep70
#> 2068          TRUE                 678.3751               678.0277    Pep1519
#> 2069          TRUE                 640.9155               640.9193    Pep1520
#> 2070          TRUE                 773.9158               773.9127    Pep1521
#> 2071          TRUE                 629.3507               629.0220    Pep1522
#> 2072          TRUE                 427.2339               426.7267    Pep1523
#> 2073          TRUE                 684.9431               684.9435    Pep1524
#> 2074          TRUE                 588.2945               588.2882    Pep2514
#> 2075          TRUE                 704.9208               704.4056    Pep1526
#> 2076          TRUE                1052.8097              1052.5450    Pep1527
#> 2077          TRUE                 892.7399               892.7365    Pep1528
#> 2078          TRUE                 496.2722               496.2696    Pep1529
#> 2079          TRUE                 980.5539               980.5649    Pep1530
#> 2080          TRUE                 980.5539               980.0345    Pep1531
#> 2081          TRUE                 539.9874               539.9885    Pep1532
#> 2082          TRUE                 458.3008               457.7947    Pep1533
#> 2083          TRUE                 802.1208               801.7883    Pep1534
#> 2084          TRUE                 875.4841               874.9976    Pep1535
#> 2085          TRUE                 875.4841               874.9976    Pep1535
#> 2086          TRUE                 564.3469               563.8382      Pep78
#> 2087          TRUE                 535.3032               535.2963    Pep1536
#> 2088          TRUE                 896.4974               896.5005    Pep1537
#> 2089          TRUE                 708.7410               708.7502    Pep2526
#> 2090          TRUE                 624.0165               623.6880    Pep1539
#> 2091          TRUE                 674.8975               674.3964    Pep1540
#> 2092          TRUE                 801.9182               801.6641    Pep1541
#> 2093          TRUE                 785.0914               785.0801    Pep2530
#> 2094          TRUE                 416.7540               416.2527    Pep1543
#> 2095          TRUE                 486.3194               485.8114    Pep2532
#> 2096          TRUE                 627.6927               627.3498    Pep1545
#> 2097          TRUE                 759.4456               759.4340    Pep1546
#> 2098          TRUE                 427.8756               427.5496    Pep2535
#> 2099          TRUE                 664.0175               663.6956    Pep1548
#> 2100          TRUE                 845.9653               845.9618    Pep1549
#> 2101          TRUE                 807.6660               807.4255    Pep1550
#> 2102          TRUE                 992.0256               991.5313    Pep1551
#> 2103          TRUE                 821.7948               821.4586    Pep1552
#> 2104          TRUE                 881.1390               880.8217    Pep1553
#> 2105          TRUE                 922.0316               921.5245    Pep1554
#> 2106          TRUE                 489.3040               488.7966     Pep398
#> 2107          TRUE                1091.5331              1091.0378    Pep2543
#> 2108          TRUE                 565.8469               565.3381    Pep1557
#> 2109          TRUE                 592.0067               592.0114    Pep1558
#> 2110          TRUE                 632.0215               631.6757    Pep1559
#> 2111          TRUE                 503.3072               503.3012    Pep1560
#> 2112          TRUE                 879.5209               879.0074    Pep2548
#> 2113          TRUE                 678.9012               678.9016    Pep1561
#> 2114          TRUE                 855.1902               855.2015    Pep1562
#> 2115          TRUE                 593.0117               592.6749    Pep1563
#> 2116          TRUE                 895.4244               895.4268    Pep1564
#> 2117          TRUE                 618.8779               618.3702    Pep1565
#> 2118          TRUE                 777.8950               777.8939    Pep3540
#> 2119          TRUE                 924.5074               924.5190    Pep1567
#> 2120          TRUE                 465.2999               465.2968    Pep2555
#> 2121          TRUE                1196.1525              1195.6301    Pep2556
#> 2122          TRUE                 943.5216               943.5118    Pep1570
#> 2123          TRUE                 751.9048               751.8992    Pep1571
#> 2124          TRUE                1018.5349              1018.5289    Pep1572
#> 2125          TRUE                1018.5349              1018.1864    Pep1573
#> 2126          TRUE                 578.8579               578.8624    Pep1574
#> 2127          TRUE                 517.3067               517.3043    Pep1575
#> 2128          TRUE                 633.6989               633.7010    Pep2563
#> 2129          TRUE                 765.4509               764.9376    Pep1577
#> 2130          TRUE                 534.6532               534.3191    Pep1578
#> 2131          TRUE                 898.4768               898.1432    Pep2566
#> 2132          TRUE                 910.1550               909.8256    Pep2567
#> 2133          TRUE                 724.9147               724.9189    Pep1581
#> 2134          TRUE                 723.4621               723.4681    Pep2569
#> 2135          TRUE                 905.0036               904.5142    Pep2570
#> 2136          TRUE                 546.8298               546.3183    Pep1584
#> 2137          TRUE                 780.6829               780.6966    Pep1585
#> 2138          TRUE                 893.4952               893.4783     Pep750
#> 2139          TRUE                1086.6083              1086.6035    Pep2574
#> 2140          TRUE                 656.0281               655.6924    Pep1587
#> 2141          TRUE                 549.5592               549.3168    Pep1588
#> 2142          TRUE                 846.7467               846.7562    Pep1589
#> 2143          TRUE                 963.5317               963.1852    Pep1590
#> 2144          TRUE                 912.5063               912.1630    Pep1591
#> 2145          TRUE                 800.9150               800.9043    Pep1592
#> 2146          TRUE                 619.1194               619.1179    Pep2581
#> 2147          TRUE                 562.6534               562.3284    Pep1594
#> 2148          TRUE                 621.3754               620.8799    Pep1595
#> 2149          TRUE                 450.2971               449.8009    Pep1596
#> 2150          TRUE                 947.5298               947.0151    Pep1597
#> 2151          TRUE                 783.1139               782.7858    Pep1598
#> 2152          TRUE                 583.6671               583.6562    Pep1599
#> 2153          TRUE                1142.0868              1141.5980    Pep1600
#> 2154          TRUE                 687.8997               687.3986    Pep2589
#> 2155          TRUE                 807.7506               807.7612    Pep1601
#> 2156          TRUE                 517.7965               517.3043    Pep1602
#> 2157          TRUE                 718.4315               717.9194    Pep1603
#> 2158          TRUE                 971.9879               971.5021    Pep1604
#> 2159          TRUE                 495.3121               495.3107    Pep1605
#> 2160          TRUE                 738.9120               738.9233    Pep1606
#> 2161          TRUE                 939.5715               939.5804    Pep1607
#> 2162          TRUE                 714.4091               714.4026    Pep1608
#> 2163          TRUE                 534.3218               534.3322    Pep1609
#> 2164          TRUE                 722.4537               722.1232    Pep1610
#> 2165          TRUE                 420.9368               420.9348    Pep1611
#> 2166          TRUE                 788.4508               787.9361    Pep1612
#> 2167          TRUE                 523.3145               522.9731    Pep1613
#> 2168          TRUE                 765.4423               764.9264    Pep1614
#> 2169          TRUE                 481.2762               481.2709    Pep1615
#> 2170          TRUE                 872.7863               872.4517    Pep1616
#> 2171          TRUE                 671.0383               671.0334    Pep1617
#> 2172          TRUE                1002.5761              1002.5605    Pep1618
#> 2173          TRUE                 489.6102               489.6124    Pep1619
#> 2174          TRUE                1388.2202              1387.7257    Pep1620
#> 2175          TRUE                 563.3353               563.3296    Pep3584
#> 2176          TRUE                 704.9333               704.4202    Pep1622
#> 2177          TRUE                 733.0667               733.0588    Pep1623
#> 2178          TRUE                 733.0667               732.7255    Pep1624
#> 2179          TRUE                 446.7596               446.7592    Pep3587
#> 2180          TRUE                 583.8283               583.8307    Pep1626
#> 2181          TRUE                 552.0010               552.0052    Pep1627
#> 2182          TRUE                 987.5477               987.5613    Pep1628
#> 2183          TRUE                 805.1295               804.7897    Pep1629
#> 2184          TRUE                 415.7739               415.2719    Pep1630
#> 2185          TRUE                 647.8742               647.8630    Pep1631
#> 2186          TRUE                 567.2974               566.7982    Pep1632
#> 2187          TRUE                 628.3828               628.3903    Pep1633
#> 2188          TRUE                 737.4811               737.4907    Pep1634
#> 2189          TRUE                 637.8688               637.3781     Pep419
#> 2190          TRUE                1126.8875              1126.5461    Pep1635
#> 2191          TRUE                1002.2043              1001.8557     Pep651
#> 2192          TRUE                 680.8681               680.3627    Pep1636
#> 2193          TRUE                 680.8681               680.3627    Pep1636
#> 2194          TRUE                 867.4864               867.4921    Pep1637
#> 2195          TRUE                 807.9608               807.9517    Pep1638
#> 2196          TRUE                 731.7164               731.7059    Pep1639
#> 2197          TRUE                 644.6274               644.3655     Pep848
#> 2198          TRUE                 854.9628               854.9545    Pep2627
#> 2199          TRUE                 646.8421               646.3489    Pep1641
#> 2200          TRUE                 610.2910               610.2990    Pep2629
#> 2201          TRUE                 814.1089               813.7800    Pep1643
#> 2202          TRUE                 405.9292               405.9314    Pep2631
#> 2203          TRUE                 607.0408               606.6951    Pep2632
#> 2204          TRUE                 516.7949               516.7878    Pep1646
#> 2205          TRUE                 867.9798               867.4793    Pep1647
#> 2206          TRUE                 839.4563               838.9450    Pep1648
#> 2207          TRUE                 705.8992               705.3986    Pep1649
#> 2208          TRUE                 489.3057               489.3107    Pep2637
#> 2209          TRUE                 905.1496               904.8237    Pep1651
#> 2210          TRUE                 905.1496               904.8298    Pep1652
#> 2211          TRUE                 528.3107               527.8132    Pep2640
#> 2212          TRUE                 790.4196               790.4293    Pep1653
#> 2213          TRUE                 731.4129               730.8991    Pep1654
#> 2214          TRUE                 434.7716               434.2741    Pep1655
#> 2215          TRUE                 473.3264               472.8288    Pep1656
#> 2216          TRUE                 459.2424               459.2348    Pep1657
#> 2217          TRUE                 459.2424               458.9095    Pep1658
#> 2218          TRUE                 510.3201               509.8227    Pep1659
#> 2219          TRUE                 466.2831               465.7776    Pep1660
#> 2220          TRUE                 811.4250               811.1044    Pep2646
#> 2221          TRUE                 919.8194               919.8132    Pep1662
#> 2222          TRUE                 508.8176               508.3172    Pep1663
#> 2223          TRUE                1103.5861              1103.5881     Pep341
#> 2224          TRUE                 885.7093               885.4481    Pep2650
#> 2225          TRUE                 569.8715               569.3713    Pep1665
#> 2226          TRUE                 871.8074               871.8033    Pep1666
#> 2227          TRUE                1111.0800              1111.0955    Pep1667
#> 2228          TRUE                 682.3965               682.0519     Pep566
#> 2229          TRUE                 654.6766               654.6647    Pep1668
#> 2230          TRUE                 916.0620               915.5523    Pep1669
#> 2231          TRUE                 709.3931               709.0554    Pep1670
#> 2232          TRUE                 759.9009               759.9058    Pep1671
#> 2233          TRUE                 629.3441               629.3554    Pep2656
#> 2234          TRUE                 470.2521               470.2492    Pep1673
#> 2235          TRUE                1099.1400              1098.6322    Pep1674
#> 2236          TRUE                 834.8072               834.8112    Pep1675
#> 2237          TRUE                 480.7636               480.7703    Pep1676
#> 2238          TRUE                 803.4539               803.4460    Pep1677
#> 2239          TRUE                 620.0215               619.6899    Pep1678
#> 2240          TRUE                 715.6622               715.4208    Pep2087
#> 2241          TRUE                 566.3647               565.8526    Pep1680
#> 2242          TRUE                 422.2469               421.9058    Pep2664
#> 2243          TRUE                 682.4061               682.4004    Pep1682
#> 2244          TRUE                 528.3302               528.3322    Pep1683
#> 2245          TRUE                 485.6467               485.6428    Pep2667
#> 2246          TRUE                 572.3125               572.3177    Pep1684
#> 2247          TRUE                 905.0099               904.5093    Pep2669
#> 2248          TRUE                 781.5094               781.4954    Pep1686
#> 2249          TRUE                 581.3336               580.8416     Pep599
#> 2250          TRUE                 894.4910               893.9833    Pep1284
#> 2251          TRUE                 436.2453               436.2408    Pep1687
#> 2252          TRUE                 533.3315               533.3244    Pep1688
#> 2253          TRUE                 649.8748               649.8680    Pep1689
#> 2254          TRUE                 590.8587               590.3571    Pep3656
#> 2255          TRUE                 554.6229               554.6297    Pep1691
#> 2256          TRUE                 904.8210               904.8218     Pep561
#> 2257          TRUE                 857.4592               857.4555    Pep1692
#> 2258          TRUE                 418.5780               418.2497    Pep1693
#> 2259          TRUE                 836.4236               836.4177    Pep1694
#> 2260          TRUE                 702.4104               702.0631    Pep3661
#> 2261          TRUE                 534.3101               533.8038    Pep2683
#> 2262          TRUE                 634.8626               634.3493    Pep1697
#> 2263          TRUE                 613.8809               613.8757    Pep1698
#> 2264          TRUE                 754.4117               754.4156    Pep1699
#> 2265          TRUE                 654.4158               654.4228    Pep3882
#> 2266          TRUE                 417.9236               417.9277    Pep1701
#> 2267          TRUE                 453.7922               453.2820    Pep1702
#> 2268          TRUE                 994.5301               994.5245    Pep1703
#> 2269          TRUE                 859.9895               859.9886    Pep1704
#> 2270          TRUE                 588.8571               588.3484    Pep1705
#> 2271          TRUE                 779.9659               779.4685    Pep2692
#> 2272          TRUE                 689.3809               689.3884    Pep1405
#> 2273          TRUE                 776.7501               776.7605    Pep1708
#> 2274          TRUE                 693.3918               693.3840    Pep1709
#> 2275          TRUE                 693.3918               693.3840    Pep1710
#> 2276          TRUE                 886.8118               886.8061    Pep2695
#> 2277          TRUE                 627.0789               627.0740    Pep2696
#> 2278          TRUE                 998.5652               998.0753    Pep1713
#> 2279          TRUE                 498.9509               498.6231    Pep1714
#> 2280          TRUE                 744.4244               744.4250    Pep1715
#> 2281          TRUE                 744.4244               744.4125    Pep1716
#> 2282          TRUE                 624.0334               624.0217    Pep1717
#> 2283          TRUE                 769.4812               769.4699    Pep3681
#> 2284          TRUE                 907.8284               907.8192    Pep1719
#> 2285          TRUE                 478.9674               478.6344    Pep1720
#> 2286          TRUE                 903.9849               903.9769    Pep2703
#> 2287          TRUE                 673.9207               673.9296    Pep2704
#> 2288          TRUE                 406.9117               406.5753    Pep1723
#> 2289          TRUE                 406.9117               406.5753    Pep1723
#> 2290          TRUE                 610.0426               610.0400    Pep4544
#> 2291          TRUE                 821.7615               821.4388    Pep1724
#> 2292          TRUE                 778.3955               777.8867    Pep1725
#> 2293          TRUE                 866.4808               866.4832    Pep1726
#> 2294          TRUE                 465.9673               465.9721    Pep1727
#> 2295          TRUE                 639.0154               639.0204    Pep1728
#> 2296          TRUE                 758.0848               758.0818    Pep1729
#> 2297          TRUE                 838.1337               838.1207    Pep1730
#> 2298          TRUE                 711.9417               711.4512    Pep1731
#> 2299          TRUE                 896.1620               895.8178    Pep1224
#> 2300          TRUE                 710.8734               710.8646    Pep1732
#> 2301          TRUE                 651.3731               650.8597    Pep1733
#> 2302          TRUE                 495.3401               494.8300     Pep950
#> 2303          TRUE                 632.3729               631.8595    Pep1734
#> 2304          TRUE                 561.3176               561.3082    Pep1735
#> 2305          TRUE                 418.4796               418.4735    Pep1736
#> 2306          TRUE                 418.4796               418.2247    Pep1737
#> 2307          TRUE                 530.2944               530.2899    Pep1738
#> 2308          TRUE                 669.4020               668.9122    Pep2722
#> 2309          TRUE                 941.5744               941.0591    Pep2723
#> 2310          TRUE                 409.7313               409.7276    Pep1741
#> 2311          TRUE                 497.7897               497.2851    Pep1742
#> 2312          TRUE                 894.5276               894.0305    Pep1743
#> 2313          TRUE                 784.4049               783.9016    Pep1744
#> 2314          TRUE                 975.0312               974.5342    Pep1745
#> 2315          TRUE                 828.1402               828.1490    Pep1746
#> 2316          TRUE                 849.0024               848.4863    Pep1747
#> 2317          TRUE                 759.4143               759.4168    Pep1748
#> 2318          TRUE                 737.4119               737.4067    Pep1749
#> 2319          TRUE                 640.3757               640.3861    Pep1750
#> 2320          TRUE                 995.5234               995.0398    Pep1548
#> 2321          TRUE                 678.6937               678.6849    Pep1752
#> 2322          TRUE                 650.0454               650.0541    Pep1753
#> 2323          TRUE                 417.7298               417.7287    Pep2736
#> 2324          TRUE                 531.2999               530.9652    Pep1755
#> 2325          TRUE                 599.3538               598.8409    Pep1756
#> 2326          TRUE                 923.5098               923.5253    Pep1757
#> 2327          TRUE                 674.8883               674.8779    Pep1758
#> 2328          TRUE                 522.3303               522.3273    Pep2741
#> 2329          TRUE                 753.4072               753.0764    Pep1760
#> 2330          TRUE                 524.8059               524.2970    Pep1761
#> 2331          TRUE                 581.3339               581.3273    Pep1762
#> 2332          TRUE                 406.2434               406.2436    Pep1763
#> 2333          TRUE                 527.2911               527.2943    Pep1764
#> 2334          TRUE                 845.1357               845.1389    Pep1765
#> 2335          TRUE                 626.6700               626.6634    Pep1766
#> 2336          TRUE                 887.5209               887.5259    Pep1767
#> 2337          TRUE                1117.2340              1116.9144    Pep1768
#> 2338          TRUE                 465.9648               465.9735    Pep1769
#> 2339          TRUE                1036.5563              1036.2318    Pep1770
#> 2340          TRUE                1036.5563              1036.2145    Pep1771
#> 2341          TRUE                1172.2609              1171.9301    Pep1772
#> 2342          TRUE                 809.2003               809.2077      Pep96
#> 2343          TRUE                 875.0010               874.5112    Pep1773
#> 2344          TRUE                 966.9878               966.9940    Pep1774
#> 2345          TRUE                 446.7388               446.2378    Pep2758
#> 2346          TRUE                 614.9062               614.4166    Pep1776
#> 2347          TRUE                 714.9099               714.4208    Pep1777
#> 2348          TRUE                 999.0262               999.0391    Pep1778
#> 2349          TRUE                 431.7786               431.7721    Pep1568
#> 2350          TRUE                 519.8301               519.3289     Pep799
#> 2351          TRUE                 779.9198               779.9133    Pep1779
#> 2352          TRUE                 556.8337               556.8416    Pep1780
#> 2353          TRUE                 556.8337               556.8304    Pep1781
#> 2354          TRUE                 887.4655               887.4715    Pep1782
#> 2355          TRUE                 649.4297               648.9260    Pep1783
#> 2356          TRUE                 730.1401               730.1385    Pep2768
#> 2357          TRUE                 522.8225               522.3276    Pep1785
#> 2358          TRUE                 794.7735               794.4285    Pep2770
#> 2359          TRUE                 720.4558               719.9449    Pep2771
#> 2360          TRUE                 461.7692               461.2599    Pep2772
#> 2361          TRUE                1349.2552              1349.2422    Pep1789
#> 2362          TRUE                 588.3080               587.7969    Pep1790
#> 2363          TRUE                 712.0416               712.0490    Pep1791
#> 2364          TRUE                 944.9843               944.9813    Pep1792
#> 2365          TRUE                1002.4996              1002.0007    Pep2776
#> 2366          TRUE                 984.5509               984.0504     Pep384
#> 2367          TRUE                 642.3812               642.3863    Pep1794
#> 2368          TRUE                 537.2880               537.2962    Pep2777
#> 2369          TRUE                 653.6931               653.3469    Pep1796
#> 2370          TRUE                 472.2727               472.2636    Pep1797
#> 2371          TRUE                1061.0942              1061.0980    Pep1798
#> 2372          TRUE                 670.7153               670.7284    Pep1799
#> 2373          TRUE                 859.9843               859.9886    Pep1704
#> 2374          TRUE                 545.9963               545.9874    Pep1800
#> 2375          TRUE                 508.9760               508.9705    Pep1801
#> 2376          TRUE                 436.5823               436.5738    Pep2783
#> 2377          TRUE                 611.0020               610.6564    Pep1803
#> 2378          TRUE                 637.8730               637.3781     Pep419
#> 2379          TRUE                 428.7521               428.4940    Pep1804
#> 2380          TRUE                 554.3410               554.0045    Pep1805
#> 2381          TRUE                 554.3410               554.0045    Pep1805
#> 2382          TRUE                 548.6592               548.3311    Pep1037
#> 2383          TRUE                 556.0500               555.7968    Pep1806
#> 2384          TRUE                 538.3120               538.3113    Pep1807
#> 2385          TRUE                 616.0080               616.0109    Pep1808
#> 2386          TRUE                 588.3780               588.3722    Pep1809
#> 2387          TRUE                 756.3657               755.8679    Pep2793
#> 2388          TRUE                 434.2890               433.9530    Pep3776
#> 2389          TRUE                 985.4703               984.9544    Pep1811
#> 2390          TRUE                 632.0310               631.7058    Pep1812
#> 2391          TRUE                 707.3918               707.3892    Pep1813
#> 2392          TRUE                 733.4029               733.3952    Pep1814
#> 2393          TRUE                1260.6725              1260.1504    Pep1815
#> 2394          TRUE                 428.5892               428.5872    Pep1816
#> 2395          TRUE                 598.3362               597.9952    Pep1817
#> 2396          TRUE                 589.3545               588.8460    Pep1818
#> 2397          TRUE                1048.0540              1048.0408    Pep3782
#> 2398          TRUE                 939.0394               939.0306    Pep1820
#> 2399          TRUE                 672.8765               672.8748    Pep1821
#> 2400          TRUE                 703.9015               703.4117    Pep1822
#> 2401          TRUE                 703.9015               703.4028    Pep1823
#> 2402          TRUE                 683.7158               683.7167    Pep1824
#> 2403          TRUE                 527.3081               527.3033    Pep2808
#> 2404          TRUE                 752.1193               752.1129    Pep1826
#> 2405          TRUE                 868.4579               868.1075    Pep2810
#> 2406          TRUE                1038.1130              1038.1022    Pep2811
#> 2407          TRUE                 714.0397               713.7079    Pep2812
#> 2408          TRUE                 822.4349               822.4188    Pep1830
#> 2409          TRUE                 493.3277               493.3225    Pep1831
#> 2410          TRUE                 683.3890               682.8915    Pep1832
#> 2411          TRUE                 679.7120               679.7091    Pep2816
#> 2412          TRUE                 677.8668               677.8741     Pep324
#> 2413          TRUE                 869.1130               868.7891    Pep1835
#> 2414          TRUE                 869.1130               869.1028    Pep1836
#> 2415          TRUE                 450.7867               450.2929    Pep1837
#> 2416          TRUE                 653.3439               652.8298    Pep2820
#> 2417          TRUE                 895.5084               895.0020    Pep1839
#> 2418          TRUE                 895.5084               895.4996    Pep1840
#> 2419          TRUE                 707.7318               707.7446    Pep1841
#> 2420          TRUE                 528.9827               528.6462    Pep2824
#> 2421          TRUE                 761.4381               761.4312     Pep457
#> 2422          TRUE                 759.4481               759.4347    Pep1843
#> 2423          TRUE                 986.5986               986.6000    Pep1844
#> 2424          TRUE                 510.8297               510.8249     Pep498
#> 2425          TRUE                 748.4185               747.9068    Pep1846
#> 2426          TRUE                 739.4202               739.4147    Pep1847
#> 2427          TRUE                 739.4202               739.4097    Pep1848
#> 2428          TRUE                 959.9672               959.9767    Pep1849
#> 2429          TRUE                 689.0594               689.0663    Pep1850
#> 2430          TRUE                 563.3721               562.8598    Pep1851
#> 2431          TRUE                 617.3683               617.3568    Pep1852
#> 2432          TRUE                 718.4576               717.9438    Pep1853
#> 2433          TRUE                 568.6920               568.6883    Pep2612
#> 2434          TRUE                 671.4055               671.0723     Pep227
#> 2435          TRUE                 671.4055               671.0723     Pep227
#> 2436          TRUE                 450.5858               450.5835    Pep1855
#> 2437          TRUE                 617.3242               617.3165    Pep1856
#> 2438          TRUE                 433.2869               433.2832    Pep2342
#> 2439          TRUE                 821.4084               821.4208    Pep1858
#> 2440          TRUE                 743.9324               743.4397    Pep2838
#> 2441          TRUE                 678.8672               678.6049    Pep1860
#> 2442          TRUE                 943.8237               943.4885    Pep1861
#> 2443          TRUE                 903.5286               903.5120    Pep1862
#> 2444          TRUE                 893.4958               893.4896     Pep903
#> 2445          TRUE                 416.7491               416.2490    Pep1863
#> 2446          TRUE                 722.7014               722.6957    Pep1864
#> 2447          TRUE                 479.8071               479.8058    Pep1865
#> 2448          TRUE                 988.0193               987.5083    Pep1722
#> 2449          TRUE                 831.1064               830.7679    Pep1867
#> 2450          TRUE                 729.4071               729.4072    Pep1868
#> 2451          TRUE                 494.7955               494.2883    Pep2848
#> 2452          TRUE                 711.4238               710.9133    Pep1870
#> 2453          TRUE                 661.0460               661.0386    Pep1871
#> 2454          TRUE                 661.0460               661.0529    Pep1872
#> 2455          TRUE                 785.7335               785.7375    Pep1873
#> 2456          TRUE                 785.7335               785.7282    Pep1874
#> 2457          TRUE                 785.7335               785.7461    Pep1875
#> 2458          TRUE                 681.4122               681.4042    Pep1876
#> 2459          TRUE                 681.9033               681.8906    Pep1877
#> 2460          TRUE                 681.9033               681.8906    Pep1878
#> 2461          TRUE                 874.9965               874.4783    Pep2857
#> 2462          TRUE                 664.4001               663.8906    Pep1880
#> 2463          TRUE                 712.0693               711.7322    Pep2859
#> 2464          TRUE                 738.7717               738.7742    Pep1881
#> 2465          TRUE                 660.7145               660.7174    Pep2861
#> 2466          TRUE                 803.6677               803.4030    Pep1883
#> 2467          TRUE                1073.5311              1073.2052    Pep1884
#> 2468          TRUE                 506.9269               506.9301    Pep1885
#> 2469          TRUE                 903.9613               903.9574    Pep1886
#> 2470          TRUE                 763.4266               763.0925    Pep1887
#> 2471          TRUE                 430.2245               430.2274    Pep2867
#> 2472          TRUE                 526.8163               526.8073    Pep1888
#> 2473          TRUE                 500.3173               500.3121    Pep1889
#> 2474          TRUE                 613.8942               613.3837    Pep2870
#> 2475          TRUE                 603.4088               602.8981    Pep2748
#> 2476          TRUE                 847.4595               846.9676    Pep2871
#> 2477          TRUE                 589.8210               589.8231    Pep1890
#> 2478          TRUE                 676.3806               675.8897    Pep1891
#> 2479          TRUE                 576.0473               576.0521    Pep1892
#> 2480          TRUE                 659.8573               659.3491    Pep1893
#> 2481          TRUE                 873.5134               873.5117    Pep1894
#> 2482          TRUE                1547.7587              1547.2313    Pep1895
#> 2483          TRUE                 807.9736               807.4747    Pep1896
#> 2484          TRUE                 686.0211               685.6780    Pep1897
#> 2485          TRUE                 659.3926               659.4045    Pep3847
#> 2486          TRUE                 469.7947               469.2901     Pep698
#> 2487          TRUE                 973.0530               973.0549    Pep1899
#> 2488          TRUE                 800.2084               799.9493    Pep1900
#> 2489          TRUE                 934.8392               934.8284    Pep1901
#> 2490          TRUE                 993.2049               993.2075    Pep2885
#> 2491          TRUE                1004.0566              1003.5356    Pep1903
#> 2492          TRUE                 643.6826               643.6829    Pep1904
#> 2493          TRUE                 611.3441               610.8353    Pep1905
#> 2494          TRUE                 728.3787               727.8806    Pep1906
#> 2495          TRUE                 559.8550               559.3513    Pep1907
#> 2496          TRUE                 759.4945               759.4800    Pep1908
#> 2497          TRUE                 605.6870               605.6869    Pep1909
#> 2498          TRUE                 696.3785               696.3845    Pep2893
#> 2499          TRUE                 953.8735               953.8685    Pep2894
#> 2500          TRUE                 808.4648               808.2043    Pep1912
#> 2501          TRUE                 504.7945               504.7997    Pep2896
#> 2502          TRUE                 699.7370               699.3994    Pep1914
#> 2503          TRUE                 699.7370               699.3981    Pep1915
#> 2504          TRUE                 583.6826               583.3428    Pep1916
#> 2505          TRUE                 824.1158               823.7747    Pep1917
#> 2506          TRUE                 416.7545               416.2490    Pep1918
#> 2507          TRUE                 756.4794               756.4670    Pep2901
#> 2508          TRUE                 941.5755               941.0676     Pep652
#> 2509          TRUE                 648.3273               648.0038    Pep1604
#> 2510          TRUE                 596.3342               596.3297    Pep1920
#> 2511          TRUE                 617.8676               617.3568    Pep1921
#> 2512          TRUE                 554.0173               553.6724    Pep1922
#> 2513          TRUE                 744.4554               744.1083    Pep1923
#> 2514          TRUE                 558.3116               558.3127    Pep1924
#> 2515          TRUE                 629.8950               629.8888    Pep1925
#> 2516          TRUE                 516.2957               516.2909    Pep2909
#> 2517          TRUE                 403.4879               403.4889    Pep1927
#> 2518          TRUE                 734.4222               733.9203    Pep1928
#> 2519          TRUE                 402.9358               402.5949    Pep3873
#> 2520          TRUE                 525.3113               525.3018    Pep1930
#> 2521          TRUE                 926.7107               926.7271    Pep1931
#> 2522          TRUE                 762.3925               762.3900    Pep1932
#> 2523          TRUE                 564.3748               564.3666    Pep1933
#> 2524          TRUE                1046.0735              1046.0544    Pep1934
#> 2525          TRUE                 443.4608               443.4593    Pep1935
#> 2526          TRUE                1004.5572              1004.5397    Pep1936
#> 2527          TRUE                 910.5020               910.5105    Pep2920
#> 2528          TRUE                 495.3402               494.8300    Pep1938
#> 2529          TRUE                 614.3780               613.8757    Pep1939
#> 2530          TRUE                 447.2735               447.2650    Pep1940
#> 2531          TRUE                 743.9045               743.8917    Pep1941
#> 2532          TRUE                 475.2884               474.7856    Pep1074
#> 2533          TRUE                 742.7322               742.7462    Pep1942
#> 2534          TRUE                 679.9127               679.4061    Pep2926
#> 2535          TRUE                1032.2329              1032.2142    Pep1944
#> 2536          TRUE                 481.2712               481.2693    Pep1945
#> 2537          TRUE                 711.3325               710.8444    Pep1946
#> 2538          TRUE                 857.1846               856.8363    Pep1947
#> 2539          TRUE                 503.3015               502.8036     Pep613
#> 2540          TRUE                 631.8818               631.3731    Pep1948
#> 2541          TRUE                 892.1422               891.8098    Pep1949
#> 2542          TRUE                 892.1422               891.8080    Pep1950
#> 2543          TRUE                 436.5873               436.5799    Pep1951
#> 2544          TRUE                 735.9015               735.9124    Pep1952
#> 2545          TRUE                 871.9587               871.9608    Pep1953
#> 2546          TRUE                 709.8847               709.8810    Pep1954
#> 2547          TRUE                 821.7992               821.4698    Pep1955
#> 2548          TRUE                 875.4628               874.9632    Pep1956
#> 2549          TRUE                 530.8180               530.3115    Pep2941
#> 2550          TRUE                 817.9461               817.9361    Pep1958
#> 2551          TRUE                 439.7745               439.7696    Pep2943
#> 2552          TRUE                 732.0894               731.7587    Pep1960
#> 2553          TRUE                 858.4891               858.4868    Pep1961
#> 2554          TRUE                 544.3506               543.8428     Pep954
#> 2555          TRUE                 896.7969               896.7865    Pep1962
#> 2556          TRUE                 839.4424               839.4503    Pep1963
#> 2557          TRUE                 838.4376               838.4256    Pep1964
#> 2558          TRUE                 457.7903               457.2868    Pep1965
#> 2559          TRUE                 962.1882               962.1957    Pep1966
#> 2560          TRUE                 962.1882               962.1957    Pep1966
#> 2561          TRUE                 962.1882               962.1957    Pep1966
#> 2562          TRUE                 962.1882               962.1957    Pep1966
#> 2563          TRUE                 623.8807               623.3693    Pep1967
#> 2564          TRUE                 750.4254               749.9268    Pep1968
#> 2565          TRUE                 433.5871               433.2520    Pep1969
#> 2566          TRUE                 749.9070               749.3921    Pep1970
#> 2567          TRUE                 579.3466               578.8365    Pep2958
#> 2568          TRUE                1182.6392              1182.1501    Pep1972
#> 2569          TRUE                 594.9708               594.9773    Pep1247
#> 2570          TRUE                 579.6586               579.6503    Pep1973
#>